KEGG   Leuconostoc sp. C2: LGMK_01635Help
Entry
LGMK_01635        CDS       T01567                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lec  Leuconostoc sp. C2
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lec00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
345061..345636
Genome map
AA seq 191 aa AA seqDB search
MTMFNDEKTTTLMQGVTNLLRVIGDDDKREGLIETPMRVVKAQAEIFAHTGEAQFDDFKL
FSTTNDADMVIVESIPFYSMCEHHLLPFFGTVDVAYVPDGQIIGLSKIPRLIEWASRRPN
VQENLTHLIASEMNRIVAPKGVAVNVTARHMCMEMRGINQPGTQTNTAIYRGLLQTDTFL
KESFTHRVNKH
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgtttaacgatgaaaaaaccacaactttaatgcaaggtgtcaccaatctatta
agagtgattggtgatgatgacaagcgcgagggattaattgagacgcccatgcgtgttgtt
aaagcgcaagctgaaatttttgcgcacactggcgaggcgcaatttgatgattttaaatta
ttcagcactacaaatgatgctgacatggtcattgttgaaagcataccattttattccatg
tgtgaacatcatttattgcctttttttgggacagtagatgttgcttatgtccctgatggt
caaattattggtctgagtaaaataccgcgattgattgaatgggctagtcgccgaccgaat
gtccaagaaaatttaacgcacttaattgccagtgaaatgaatcgtattgttgcgcccaag
ggtgtagcagtaaatgttacggctaggcatatgtgtatggaaatgcgtgggatcaaccaa
ccagggacacagactaacacagcaatttatcgtggtctactacagacagatacattttta
aaggaaagttttacacatcgtgtaaacaaacactaa

DBGET integrated database retrieval system