KEGG   Leuconostoc sp. C2: LGMK_01635Help
Entry
LGMK_01635        CDS       T01567                                 

Definition
(GenBank) GTP cyclohydrolase I
Organism
lec  Leuconostoc sp. C2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
345061..345636
Genome map
AA seq 191 aa AA seqDB search
MTMFNDEKTTTLMQGVTNLLRVIGDDDKREGLIETPMRVVKAQAEIFAHTGEAQFDDFKL
FSTTNDADMVIVESIPFYSMCEHHLLPFFGTVDVAYVPDGQIIGLSKIPRLIEWASRRPN
VQENLTHLIASEMNRIVAPKGVAVNVTARHMCMEMRGINQPGTQTNTAIYRGLLQTDTFL
KESFTHRVNKH
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgtttaacgatgaaaaaaccacaactttaatgcaaggtgtcaccaatctatta
agagtgattggtgatgatgacaagcgcgagggattaattgagacgcccatgcgtgttgtt
aaagcgcaagctgaaatttttgcgcacactggcgaggcgcaatttgatgattttaaatta
ttcagcactacaaatgatgctgacatggtcattgttgaaagcataccattttattccatg
tgtgaacatcatttattgcctttttttgggacagtagatgttgcttatgtccctgatggt
caaattattggtctgagtaaaataccgcgattgattgaatgggctagtcgccgaccgaat
gtccaagaaaatttaacgcacttaattgccagtgaaatgaatcgtattgttgcgcccaag
ggtgtagcagtaaatgttacggctaggcatatgtgtatggaaatgcgtgggatcaaccaa
ccagggacacagactaacacagcaatttatcgtggtctactacagacagatacattttta
aaggaaagttttacacatcgtgtaaacaaacactaa

DBGET integrated database retrieval system