KEGG   Leuconostoc sp. C2: LGMK_02510Help
Entry
LGMK_02510        CDS       T01567                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00260  Glycine, serine and threonine metabolism
lec00750  Vitamin B6 metabolism
lec01100  Metabolic pathways
lec01110  Biosynthesis of secondary metabolites
lec01120  Microbial metabolism in diverse environments
lec01230  Biosynthesis of amino acids
Module
lec_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGMK_02510
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LGMK_02510
Enzymes [BR:lec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LGMK_02510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEJ30560
Position
complement(513776..515236)
Genome map
AA seq 486 aa AA seqDB search
MNYISTRGQAPAVTASQAILNGIAPDGGLYVPEDWPDIKLDWAVLKKQTYSDIATQIFDA
FFDDFSVAEIDHVVTKAYGKQWDTTNIVSTHQEADLTYMELFHGPTLAFKDIALQALPHL
LTTAAKKQGTRDKIIILTATSGDTGTAAMSGFGNVEQTEIVVFYPEVGVSDIQRQQMKTE
SADNAHVIAITGNFDDAQKAVKSLLSDQRLVHDLQTNQMQFSSANSINIGRLVPQIVYYI
YTYAQLVKNNNIKPGDAINIVVPTGNFGNILAAYYANQIGLPVKQFVVASNENNVLTDFF
KTGKYDRQRAFKVTNAPAMDILVSSNLERLLYFASGKNSEEIRNYMRDLSEKGEYTLNSA
TRQNLSQFVSGFATQTQVSETIKAVARATQYTIDPHTAVARYVYGKQEIAGPTLLAATAS
PYKFPQTVLQALGITPQADFEALKQLAQATNTDIPSPVMDLFAKPVRHKQVIAAKEILAT
LRHEIL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaactatatttcaacacgtggtcaagcaccagcagttacagccagccaagctatttta
aatggtatcgcaccagacggtggtctgtatgtacctgaagattggcctgacataaagctt
gattgggcagtactaaaaaagcaaacttattcagatattgcgacccaaatttttgatgca
ttttttgatgatttcagtgttgctgaaattgatcatgtggtcaccaaggcttatggcaaa
cagtgggatacaacaaacattgtatcgactcatcaagaggcagacctgacatatatggaa
ttgtttcatgggccaacgctcgccttcaaggatattgctttacaggcattgccacattta
ctaacaactgctgcaaaaaagcagggcacgcgtgataaaattattattctaactgctact
tctggtgatacagggactgctgcgatgagcggttttggaaatgttgagcagacagagatt
gttgttttctatccggaagttggtgtcagtgatattcaacggcaacagatgaaaactgaa
tctgctgataatgctcatgttattgccattacaggtaactttgatgatgctcaaaaagcg
gttaaatcattattatctgatcagagattagtacatgacttacagactaatcagatgcag
ttttcatcggctaattcgattaatattggccgtttagtgcctcaaattgtctattatatt
tacacgtacgcgcaattagttaaaaataataatattaaacctggtgatgccattaatatt
gttgtaccaactggtaattttggtaatatcttagcagcctactatgcgaatcagataggt
ctacctgtcaagcagtttgtggtcgcatcaaatgaaaataatgtcctaacagacttcttt
aaaactggtaaatatgatcgtcagcgtgcttttaaagttacaaacgcaccagccatggat
attcttgtgtctagtaatttagagcgcttattatattttgctagtggtaaaaatagtgaa
gaaatcagaaactacatgcgtgatttgtctgaaaaaggcgaatatacgttaaattctgct
acacgtcagaatttgtctcagtttgtttcaggatttgcgacgcaaacacaagtgtctgaa
acaattaaagcggttgcaagggcgacacaatatacgattgatccacatacagcggttgca
cgatatgtttatggtaaacaagaaattgcagggccaacactccttgctgctactgctagc
ccttataaatttccacaaactgtattgcaggccttaggaataacaccgcaagctgatttt
gaagctttaaaacaattagcacaagctactaatactgatataccgtcaccggtgatggac
ttgtttgctaaaccagttcgtcataaacaagtcattgctgctaaagaaattctagcaact
ttacgacacgaaatactttaa

DBGET integrated database retrieval system