KEGG   Leuconostoc sp. C2: LGMK_02640Help
Entry
LGMK_02640        CDS       T01567                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lec  Leuconostoc sp. C2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lec00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lec00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(543791..544306)
Genome map
AA seq 171 aa AA seqDB search
MTKIKMVWAEDREHAIGKNGNLPWRLPDDLKLFREETTNTLMIMGRTTWSSIGRPLPNRQ
TLVLTRQADWQIPFEDVLVTHSVAETLDTIRAESKDVAIAGGAAIYRAFMPYATDLIVTR
IDGIINGDTFVDAIDLTTFELVSRQPHDKDDRHDYAFVVERYKRRNRGENV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattaaaatggtctgggcggaggatagggaacatgctattggaaaaaatggt
aacttaccatggcgcctaccagatgatttgaagctttttcgtgaagaaaccactaatacc
ttgatgatcatgggtcgtacaacatggtcgagcattggtcgcccgttaccaaatcgtcaa
acgcttgtgttgacaagacaagcagattggcaaataccttttgaagatgttttggtgaca
cattcagttgcggaaacattggatactattcgagctgaatccaaagatgttgccattgct
ggcggcgcagcgatttatcgcgcgtttatgccgtatgccacagatctgattgtaacgcgt
attgatggtataattaacggtgatacatttgtagatgcgattgatttgacaacttttgag
ttagtcagtcgtcagccgcatgacaaagatgacaggcacgactatgcgtttgttgtggag
cgttataagcgtagaaatcgaggagagaatgtctaa

DBGET integrated database retrieval system