KEGG   Leuconostoc sp. C2: LGMK_03205Help
Entry
LGMK_03205        CDS       T01567                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lec  Leuconostoc sp. C2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LGMK_03205
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGMK_03205
   00052 Galactose metabolism
    LGMK_03205
   00500 Starch and sucrose metabolism
    LGMK_03205
   00520 Amino sugar and nucleotide sugar metabolism
    LGMK_03205
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LGMK_03205
   00524 Butirosin and neomycin biosynthesis
    LGMK_03205
Enzymes [BR:lec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LGMK_03205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(649284..650273)
Genome map
AA seq 329 aa AA seqDB search
MVRIDQALTNMAKDKLIGVDLGGTTIKFAILTEDGEIQQKWSIKTNIFDQGAHIVPDIID
SINHHLDLYQLDAERIIGIGMGTPGTVNRQTGTVTGAFNLNWKTEQAVKADIEAGTGFTL
TIDNDANAAALGEAWRGAGNNDGEVSFITLGTGVGGGLVANGELIHGTAGAGGEVGHVIV
EPNGYLCTCGNRGCLEQYTSATGVVHLAQDFAEEYVGSSKLKELISNGEEVTSKIVFDLA
KNGDFLANEVVNKVAYYLGYATAAMANILNPSAIVIGGGVAAAGEFLRARVEKNWQMFAF
PTVRQSTRVKLAELGNDAGVIGAASLARV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttggttcgaattgaccaagcattaactaacatggctaaagataaattaattggtgttgac
cttggcggtacgacgatcaaattcgctattttaactgaagatggcgaaattcaacaaaag
tggtcgattaaaacaaatatatttgatcaaggggcacatattgtgccagatattattgat
tcaattaatcatcatcttgatttgtaccaacttgatgcagaacgtattattggtattggc
atggggacaccgggaactgtaaaccgtcaaactggtacggtaacaggtgcattcaattta
aattggaaaacagaacaagcggttaaagcagatattgaagcaggcacaggatttacgctg
acaattgataatgatgccaatgcagctgcattgggagaagcatggcgcggtgcaggtaac
aacgatggtgaagtctcattcatcacgcttggtactggcgttggtggtggcttagttgcc
aatggtgagctaattcacggtacagctggtgcaggtggtgaagttgggcatgttattgtc
gaaccaaacggttatttgtgcacatgtggtaatcgcggttgtttagaacaatatacttca
gccacaggcgttgttcatttggcacaagattttgctgaagaatatgttggctcatctaaa
cttaaagaattaatttctaatggtgaagaagtgacttcaaaaatcgtatttgatttggca
aaaaatggtgattttctagccaatgaggtggtgaataaagttgcttattatttgggctac
gcaacggcggccatggctaatattctcaacccttcagctattgttattggtggtggtgtt
gcggcagctggtgaatttttgcgcgcgcgtgtcgaaaaaaattggcagatgttcgctttt
ccaacagtgcgtcaaagtacacgtgtaaaattagctgagttaggcaatgatgcgggtgtc
attggtgctgcttcattggctcgtgtctaa

DBGET integrated database retrieval system