KEGG   Leuconostoc sp. C2: LGMK_03765Help
Entry
LGMK_03765        CDS       T01567                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lec  Leuconostoc sp. C2
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lec00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(771211..772662)
Genome map
AA seq 483 aa AA seqDB search
MKKLTNEAMLITYADSLGKNLKELNQVLTNELDGVVGGVHVLPFFPSTGDRGFAPEEYET
VDPKFGDWSDVEKLADKYYLMFDFMLNHISPQSKYFQDFLEKKEESEYYDMFLKYSEFWP
ENRPTDADIDMIYKRKDKAPFAPVTFADGTTDQVWNTFGDQQMDLDVTKEVTKKFIKDSL
VNLAHHGASVIRLDAFAYAIKKLDTNDFFVEPEIWAILDEVREILAAEGSEVLPEIHEHY
KIVRKITDHDMYSYDFALPLLTLYSLYSGKTNRIADWLRQSPMKQFTTLDTHDGIGVVDA
KDLLTQEETDFTTEEMYKVGANVKKIFSSAAYNNLDIYQINTTYYSALGNNDAAYLLARA
TQIFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYDLAEIAETTKRPVVSNLFDL
LRFRNTSAAFDLEGKIEVVNDGENELTVTRSSADGKTVAVLDANFATKNFTVTENGKEIF
TTK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgacaaacgaagcaatgcttatcacatatgctgactcacttggaaagaac
ttaaaggaacttaatcaagtattgactaacgaacttgatggtgtcgtgggtggcgttcac
gtcttaccatttttcccatcaactggcgatcgtggctttgcacctgaagaatacgaaaca
gtagatccaaagtttggtgactggtctgatgttgaaaaattagcagataagtattactta
atgtttgattttatgttgaaccatatttcaccacaatcaaagtacttccaagactttttg
gaaaagaaggaagagtcagaatattatgatatgttcttgaagtattcagaattttggcca
gaaaaccgtccaacagatgcagatattgatatgatctacaagcgtaaggataaggcaccg
tttgctcctgtgacatttgctgacggtacaactgaccaagtttggaacacatttggtgat
caacaaatggatttggatgttactaaagaagtaacaaagaagtttattaaagattcattg
gttaatttggctcatcatggtgcttctgttattcgtttggatgccttcgcatatgctatt
aaaaagttagacacaaatgatttcttcgttgaacctgaaatttgggctattttagatgaa
gtacgtgaaattttggccgcagaaggttcagaagtattacctgaaattcatgaacactac
aaaattgttcgtaaaattactgatcatgacatgtattcatacgactttgcattaccatta
ttgacattgtattcactatactcaggtaagacaaaccgtattgctgattggctacgtcaa
agtccaatgaagcaattcacaacattggatacgcatgacggtattggcgttgttgatgca
aaagatttgttgactcaagaagaaacagatttcacaactgaagaaatgtataaggttggg
gcaaatgttaagaagatattctcttcagctgcttacaacaacttggatatttatcaaatt
aacacaacttactattcagcattgggtaacaacgacgcagcttacttattagcacgtgcc
acacaaatctttgcgcctggtattccacaaatttattatgttggtttgcttgctggtgaa
aatgatatcgaacttttggaaagctcaaaagaaggtcgtaacattaaccgccattattat
gatttggctgaaattgctgaaacaacaaagcgaccagtagtttcaaacttgtttgatttg
ctacgcttccgcaatacaagcgctgcctttgatttagaaggtaaaattgaagttgttaat
gatggtgaaaatgaattaacagtaacacgttcatcagcagatggtaagacagtcgctgta
ttggatgctaactttgcaactaaaaactttactgtaactgaaaatggtaaagaaatattt
acgacaaagtaa

DBGET integrated database retrieval system