KEGG   Leuconostoc sp. C2: LGMK_03965Help
Entry
LGMK_03965        CDS       T01567                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lec  Leuconostoc sp. C2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lec01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lec00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(810001..811278)
Genome map
AA seq 425 aa AA seqDB search
MQIIKNESINQIKARIRQQTLKTVDPQVENRVADIIATVREKGDVALKSYAKAFDDVSLD
VLKVSSSQINQAMKSVDPEVIAALEKAAANIRSFHQLELQTSFEDSPRPGVLRGTKVTAL
SAVGIYVPGGTAAYPSSVLMNALPAKIAGVKNIIMVTPPQKDGTNPVVLAAAKIAGIDSI
YQVGGAQAIAALAYGTESIPKVDKITGPGNAYVATAKRAVYGQVAIDMIAGPSEIGILAD
DSARPQDVAADLLSQAEHDVNARAILITNSEKLAQAVSDEVDKQLLTLPRVDIARAAVDS
NGFIYLVDTVDDMIDLMNVVAPEHLEIQLENAYDYLAKIQNAGSVFLGKYASEPLGDYLA
GPNHILPTGGTARFSSALGVWDFQKRIQYLDYSQAALSDDASDVAALAREEGLEAHARAI
EVRQS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcagattattaaaaatgagtcgattaatcaaattaaggcccgtattcgacagcaaacg
ctaaaaacagttgatccacaggttgaaaatcgtgttgctgatattattgcaactgtgcgc
gaaaaaggtgatgttgcgctaaaatcatatgccaaagcctttgatgatgtatcacttgac
gtattaaaagtgagctcatcgcaaattaaccaagcaatgaaatcggtagaccctgaagta
attgcagccttagaaaaagcagcagccaatatccgatcgtttcaccaattagagttacaa
acatcatttgaagattctccacgccctggtgtgctacgcggtaccaaagtgacagcgtta
tcagcagttggcatttatgtgcctggtggtacggcggcttacccatcatcagtcttaatg
aacgcactgccagctaaaatagccggtgttaaaaatatcattatggtaacaccaccacaa
aaagatggtaccaatccggtggtgttggcagcagccaaaatagctggcattgatagcatt
tatcaagtgggtggtgcacaagccattgcggcacttgcatacggtacagagtcaatacca
aaagtagataaaatcacggggcctggcaacgcttatgtcgccactgccaagcgcgcagtt
tacggacaagttgcgattgatatgattgcaggaccgtcagaaataggtattttagccgac
gattcggcacgtccacaagatgttgcggccgatttattgtcacaagccgagcatgatgtt
aatgcgcgagccattttgattacaaattcagaaaaattagcgcaagctgtttcggatgaa
gtggacaaacaactgctcacattgccgcgtgttgatatcgcgcgtgctgcagtcgatagt
aacggttttatttatctcgttgacacagttgatgacatgattgatttaatgaatgttgtt
gcaccagaacatttggaaattcagctggaaaatgcctatgattacttagctaaaatacaa
aatgccggctctgtatttctgggaaaatatgcctctgaacccttaggtgactaccttgcc
ggaccaaatcatattttaccaactggtggtactgcgaggtttagttcagcattgggtgtt
tgggattttcaaaagcgcattcaatatttggactattcacaagccgcgttaagcgatgat
gccagcgatgttgctgcactagcccgtgaagaggggttagaagctcacgcacgtgccatt
gaagtacgtcaatcttaa

DBGET integrated database retrieval system