KEGG   Leuconostoc sp. C2: LGMK_04005Help
Entry
LGMK_04005        CDS       T01567                                 

Definition
putative phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lec  Leuconostoc sp. C2
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGMK_04005
Enzymes [BR:lec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LGMK_04005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(818714..820150)
Genome map
AA seq 478 aa AA seqDB search
MTQSLPKDFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGGPNKARGITDGVVPGEYYPN
HEAIDFYHHYKEDISLFKEMGFKCFRTSIAWTRIYPTGEETEPNESGLKFYDDLFDELIK
HDIEPIVTLSHFELPYHLVTKYGGFRNRKLIDLFVKFATTCLQRYQGKVTYWMTFNEINN
QANYDNDFSVFTNSGLHFEPGENREEGMYQAAHNELVASARVVKIGHNINPDLKMGCMIA
MGPVYPATMAPDDVLAAQKAMEKNYFFADVHVNGFYPSFLTKYWARQGFEIDVTAQDEQD
LHNGTVDYIGFSYYMSHAIQKNEGRSFDELTMQNSLVRNTYLEASDWGWQIDPKGLRYAL
NWFTDKYHLPLFIVENGFGAYDKVEPDGSIHDDYRIDYLREHIRQMKLAVTEDGVDLIGY
TPWGCIDLVSAGTGEMDKRYGFIYVDKNNKNEGSLARSKKDSFEWFKTVIATNGEQLN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaagtttaccaaaagatttcctttgggggggagcagtagctgcacaccaactt
gaaggtggctggcaagaaggtggtaagggtatcagtgttgcagacgtaatgactgctggt
gggccgaataaagcacgtggtattacagatggcgtagtaccgggcgagtattatcctaat
catgaagcgattgatttttatcatcattacaaagaagacattagcttatttaaggaaatg
ggttttaaatgttttcgaacatcaattgcgtggactcgaatatatccaacaggagaggag
acggaaccaaacgagtcaggtttgaagttttatgatgatttgtttgatgaattgatcaaa
catgatattgagcccattgtgacgctttctcactttgaactaccttatcatctagtaacg
aaatatggtggattccgcaatcgtaagttgattgatttgtttgtgaaatttgcgacaaca
tgcttacaacgttatcaaggtaaagtaacgtattggatgacgtttaacgaaattaataat
caagcaaattatgacaatgatttctctgtgttcactaattctggattacattttgagcca
ggtgaaaatcgtgaagaagggatgtatcaagcagctcataatgaactagtggccagcgca
cgcgtagttaaaattgggcacaatattaatccagatttgaaaatgggatgtatgatcgct
atggggccagtttatccagcaacaatggccccagacgatgtactagcagctcaaaaagca
atggaaaaaaattatttctttgcggatgtccacgttaatggcttttacccatcattttta
acaaagtattgggcacgtcaaggatttgaaattgatgtgacagcacaagacgagcaagat
ttgcataatggtacagtggattatattggttttagttattatatgtcacatgcaattcag
aaaaatgaaggacgctcatttgatgagttaacgatgcaaaatagtctcgttcggaatact
tatttagaagcaagtgattggggatggcagattgaccctaaggggttgcgttatgcgtta
aattggtttaccgataaatatcatctccctttgtttattgttgagaacggctttggtgcc
tatgacaaggttgaacctgacggatcgatacatgatgattatcggattgactatttgaga
gagcatatacgtcaaatgaaattagcagtcacagaagatggtgttgatttgataggttat
acaccatggggctgcattgacttggtgtcggcgggcactggtgaaatggataagcgttac
ggtttcatatatgtggacaaaaataacaaaaatgagggttctttagctagatctaaaaaa
gattcatttgagtggttcaagacagttattgcgacaaacggtgagcagttaaattag

DBGET integrated database retrieval system