KEGG   Leuconostoc sp. C2: LGMK_05360Help
Entry
LGMK_05360        CDS       T01567                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00010  Glycolysis / Gluconeogenesis
lec00051  Fructose and mannose metabolism
lec00562  Inositol phosphate metabolism
lec01100  Metabolic pathways
lec01110  Biosynthesis of secondary metabolites
lec01120  Microbial metabolism in diverse environments
lec01130  Biosynthesis of antibiotics
lec01200  Carbon metabolism
lec01230  Biosynthesis of amino acids
Module
lec_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGMK_05360
   00051 Fructose and mannose metabolism
    LGMK_05360
   00562 Inositol phosphate metabolism
    LGMK_05360
Enzymes [BR:lec01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LGMK_05360
Exosome [BR:lec04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LGMK_05360
  Exosomal proteins of bladder cancer cells
   LGMK_05360
  Exosomal proteins of melanoma cells
   LGMK_05360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEJ31130
Position
complement(1099207..1100019)
Genome map
AA seq 270 aa AA seqDB search
MSKMHKEQRVPFVVANWKINKLQADVVDFLKKVDGKVPDQAVVETGIAAQDLFLADLVRA
TAASPIHVVAENVHWEDSGAYTGETSPKALRDIGAKYVLIGHFERRKFFNETDSTVNLKV
TAALRNGLRPIIDVDEDMSTYAQFMDAEPSVAQVAAALAGVSVDQIRNVTIAYEPTWAIG
SGEAASADQAQKAAHLIRQTLAKLYSPVIAEQVRILYGGSVTPDNAREIMAQSDIDGVLV
GTAALDPDKFLKLVAIAHDPNVPEFDVDHV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatgcataaagaacagcgcgtcccttttgtcgtggctaattggaaaattaat
aaattacaggctgatgtggttgattttttaaagaaagtcgacggtaaagtgccagatcaa
gcggttgttgagactggaattgcggcacaagatttgtttttggctgatttagtgcgtgca
accgcagcttcgccaatacatgttgttgcggaaaatgtacactgggaagacagtggcgca
tatacgggggagacctctcccaaagcgttgcgagatattggcgcaaaatatgtcttaatt
ggtcatttcgaacgtcgcaaattttttaatgaaactgattcaaccgtaaacttaaaggtt
actgctgcattgcgcaacgggttacggccaattattgatgttgatgaggacatgagtact
tatgcacaatttatggatgctgaaccctcagtggctcaagtcgctgcggcattagcaggt
gtttctgtcgatcaaattcgtaatgtgacaattgcctatgagccaacatgggcaattgga
tctggtgaagcggcaagtgctgatcaagcacaaaaggcagcacatctcattcgccaaacc
ctagccaagctgtattctcctgttattgcagaacaagtgcgtattttatatggtggttca
gtgacgccagacaatgcgagagaaattatggctcaaagtgacatagacggcgtattagtt
gggacggcagcattagatcccgacaaatttctaaaattagtcgcaattgcacatgatcca
aatgtgccagaatttgacgtagatcacgtttga

DBGET integrated database retrieval system