KEGG   Leuconostoc sp. C2: LGMK_08030Help
Entry
LGMK_08030        CDS       T01567                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lec  Leuconostoc sp. C2
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LGMK_08030
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGMK_08030
  Lipid metabolism
   00071 Fatty acid degradation
    LGMK_08030
  Amino acid metabolism
   00350 Tyrosine metabolism
    LGMK_08030
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LGMK_08030
   00626 Naphthalene degradation
    LGMK_08030
Enzymes [BR:lec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LGMK_08030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1620043..1621098)
Genome map
AA seq 351 aa AA seqDB search
MKAAVVRETPDGYVDLIDNWQPRALTFGEALVDVEYVGLCHTDLHVAGADFGNPNKMGQR
NGDFRRVIGHEGVGRVSKLAEGAGDYLKIGDRVSIAWFYDACGVCDYCVSGNETFCRNVR
NSGYTVDGAMSQQAVVNAKYAVKVPEGLDPLEATSITCAGVTMYKSLKVGETKPGQWVSV
HGAGGLGNLAVQYAHNVFGAHVAVIDGNDDKLAAAHANGAEVLINRKKVDDVAAEVQKAT
GGAHNAQVTAVNAAAFNQAVGSLRPMGKLVAVALPEGDMALNIAKTVLDGIEVRGSLVGT
RADLKEAFQFGAEGKVKPIVEKVNFKDMNDVIDEMKAGSITGRKVFDFTTL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagttgtacgtgaaacaccagatggttacgttgatttaattgataattgg
caacccagagcactaactttcggtgaagcgttggtagacgttgaatatgttggtttatgc
catacggatttgcatgttgctggggctgattttggcaaccctaataagatgggtcaacga
aatggtgattttcgccgcgtgattgggcatgaaggcgtgggccgtgtgtctaaattagct
gaaggtgccggtgattatttgaagattggtgaccgtgtgtcgattgcttggttttatgat
gcttgtggcgtttgtgattactgtgtatcaggaaatgaaacgttctgccgtaatgttcgt
aattctggctatacagtggatggtgccatgtcacagcaagcagttgtgaatgccaagtat
gcagtcaaagtaccagaaggtctggacccgcttgaagccacatcaattacatgtgctggt
gtcacaatgtataaatcacttaaagttggtgaaactaagcctggacagtgggtatcagtt
catggtgctggtggtttaggtaacttagctgtacaatatgcgcataacgtattcggtgcc
catgttgctgttattgatggcaatgatgacaaactagcagcagcacatgcaaatggtgca
gaagttttgattaatcgtaagaaggttgatgatgttgctgctgaagtgcaaaaagcaact
ggtggtgcacataacgcccaagttacggcagttaatgctgcagcctttaaccaagcggta
ggttcattacgaccaatgggtaagttggttgctgtggcgttgccagaaggtgatatggca
ttaaacattgctaaaactgtgttagatggtattgaagtacgtggctcattggttggtaca
cgtgctgatttgaaggaagctttccaatttggtgctgaaggtaaagttaagccgattgtt
gaaaaagttaactttaaggatatgaatgacgtgattgacgaaatgaaggctggtagtatt
accggtcgtaaagtatttgactttacaacactttaa

DBGET integrated database retrieval system