KEGG   Leuconostoc sp. C2: LGMK_08285Help
Entry
LGMK_08285        CDS       T01567                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00010  Glycolysis / Gluconeogenesis
lec00350  Tyrosine metabolism
lec00620  Pyruvate metabolism
lec00625  Chloroalkane and chloroalkene degradation
lec00626  Naphthalene degradation
lec00650  Butanoate metabolism
lec01100  Metabolic pathways
lec01110  Biosynthesis of secondary metabolites
lec01120  Microbial metabolism in diverse environments
lec01130  Biosynthesis of antibiotics
lec01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGMK_08285
   00620 Pyruvate metabolism
    LGMK_08285
   00650 Butanoate metabolism
    LGMK_08285
  Lipid metabolism
   00071 Fatty acid degradation
    LGMK_08285
  Amino acid metabolism
   00350 Tyrosine metabolism
    LGMK_08285
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LGMK_08285
   00626 Naphthalene degradation
    LGMK_08285
Enzymes [BR:lec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LGMK_08285
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LGMK_08285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AEJ31706
Position
complement(1673065..1675767)
Genome map
AA seq 900 aa AA seqDB search
MVETMIKKPAKKVLTPEEKAELQTQAEKMTAELVEKSQKALTAFSTFTQEQVDKIVAAMA
LAGSENSLLLAHAAHDETGRGVVEDKDTKNRFASESVYNAIKFDKTVGVISEDKIQGKVE
LAAPLGVLAGIVPTTNPTSTTIFKAMLAAKTRNTIIFAFHPQAQKSSALAAKIVYDAAVK
AGAPENFIQWIEKPSLYGTSALIQNKGIASILATGGPAMVNAALKSGNPSMGVGAGNGAI
YLDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQAPIYDEVLQKMQAQGAYLVPKKDY
KKIADYVFKPNAEGFGVAGPVAGMSGRWIAEQAGVKIPEGKDVLLFELDQKNIGEALSSE
KLSPLLSIYKVEKREEAIETVQALLSYQGAGHNAAIQIGSQDDPFIKEYADAIGASRILV
NQPDSIGGIGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWVRL
PKEVYYEANAITYLQELPAVKRAFIVADPGMVQFGFVGKVLSQLELRQEQVETNIYGSVK
PDPTLSEAVGIARQMAAFKPDTVILLGGGSALDAGKIGRFLYEYSTRHEGILEDEEGIKN
LFMELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDQTHVKYPLADY
ELTPEVAIVDPEFVMTVPKRTVAFSGLDALSHALESYVSVMSSEFTRPWALQAIKLIFEN
LTTSYQYDPKNPTKEGQNARSKMHYASTLAGMSFANAFLGINHSLAHKTGGEFGLPHGLA
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARYLGLKGNTDVELVDALIAAV
KNLAKSVEVDQTLTGNGVKKVDLENNIEKLTDLVYNDQCTPGNPRQPSLAEIRQLLRDQL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaacaatgataaagaagcctgcaaagaaggttttgacacccgaagaaaaggca
gaattacaaacccaagcagaaaaaatgacggcagaattagttgaaaaatcacaaaaagct
ttaacagcattttcaacatttacacaagagcaagttgataaaatcgtcgcagcaatggca
ttagctggctcagaaaattcattgttacttgcccatgcagctcatgatgagactggccgt
ggggtcgttgaagataaggatacaaaaaatcgctttgcctctgaatctgtatacaacgct
attaaatttgataaaacagttggtgtaatcagtgaagacaaaatacaagggaaagtcgaa
ttagcagcgccactcggtgtactagctggtattgtaccaactacgaacccaacctcaacg
acaatttttaaagccatgttggcagccaagacacgtaacacaattatctttgcattccat
ccacaagcacaaaagtcatcagcactcgctgcaaaaattgtttatgatgccgctgttaag
gctggtgcacctgaaaacttcatccaatggattgaaaagccatcactttatggcacaagt
gcattaattcaaaataagggcattgcctcaatcttggcaactggtggaccagcgatggtt
aacgcagccttgaagtcaggaaatccatcaatgggtgttggtgctggaaacggtgcgatt
tatcttgatgcgacagttgacactgaccgtgccgtgtctgatttacttttgtcaaagcgt
tttgataatggtatgatttgtgccactgaaaactcagccgttattcaagcaccaatttat
gatgaagtactacaaaaaatgcaagcgcaaggcgcttatctagtccctaaaaaagattat
aagaaaattgctgattatgtgtttaagccaaatgcagaaggatttggtgtagctggtcca
gttgctggtatgtcaggtcgttggatagctgaacaagctggtgttaaaattcctgaaggc
aaagatgtcttgctattcgaattggatcaaaagaatattggcgaagcactgtcatcagaa
aagttatcacctttactatcaatttataaagttgagaagcgtgaagaagcgattgaaaca
gtacaggcattactgagctatcagggtgcaggacataatgctgctatccaaattggttca
caagatgatccatttattaaagaatatgctgatgctattggtgcatcacgtatcttagtt
aaccaacctgattcaattggtggtattggtgacatttatacagatgctatgcgcccttct
ttgacgcttggtaccggatcatgggggaagaattcattgtctcacaacttatcaacatac
gatttgctcaatattaaaacggttgctcgccgccgtaatcgaccacaatgggttcgctta
cctaaggaagtttattatgaagcaaacgctattacttacttacaagaattaccagcagtt
aagcgtgcctttattgttgctgatccaggtatggtgcaattcggctttgttggtaaagta
ttgagccaattagaattacgtcaagaacaggttgagacaaatatctatggttcagttaag
cctgatccaacgttgtctgaagcagttggcattgcacgtcaaatggctgctttcaagcct
gatacagtgatcctattgggtggtggttcggcattggatgcgggaaagatcggtcgcttc
ttgtatgaatactcaacgcgtcatgagggtattttggaagacgaagaagggatcaaaaac
ttattcatggaattgcaacaaaagttcatggatattcgtaagcgtatcgttaagttctac
cacgcccgtttgacacaaatggtcgctattccaacaacgtctggtactggttcagaagtc
acaccatttgcggtaattaccgatgaccaaacacatgttaagtatccattagctgactat
gagttgacaccagaagtagccattgtggatccagaatttgtcatgacagtgccaaagcgt
acagtagccttttctggattagatgcactatctcatgcgttggaatcatatgtatcagtt
atgtcttctgaattcacacgaccatgggctttgcaagcgattaagttgatttttgaaaac
ctaacaacgtcataccaatatgaccctaaaaatccaaccaaggaaggtcaaaatgcccgt
tcaaagatgcactatgcttcaacactagcaggtatgtcatttgctaacgcattcttaggc
attaaccattcattggcccacaaaactggtggtgagttcggtttgcctcacggattggct
attgccattgcgatgccacatgtgattaagtttaatgccgtgacaggtaacgttaagcgc
acgccttacccacgctatgagacatatacagcacaaaaagattatgctgatattgcgcgc
taccttggcttgaagggcaatacagatgttgaattggtcgatgctttgattgctgccgtt
aagaatttggctaagtcagttgaagttgaccaaacattaacaggtaatggtgttaagaaa
gtagatctagaaaacaatattgaaaaattgacggatcttgtttataacgatcagtgcaca
cccggaaacccacgccaacctagtttggcagaaattagacaattgttgagagatcaactt
taa

DBGET integrated database retrieval system