KEGG   Leuconostoc sp. C2: LGMK_08585Help
Entry
LGMK_08585        CDS       T01567                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lec  Leuconostoc sp. C2
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lec00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1729034..1730491)
Genome map
AA seq 485 aa AA seqDB search
MYKTTYENSFPKGFLWGGATAANQIEGAWNLDGKGLSTAEVVQKADDRRKMSMGDVTEET
LAIALADKTDDLYPKRRGVDFYHHYKEDIALFAEMGFKVYRFSIAWSRIFPQGEDAQPNE
AGLVFYDNVLAELAKYDIVPLVTLSHYEMPVVLTQKYNGWAGRETIAAFNRFTETVFNRY
HDQVDYWLTFNEINTGTWGFHETGAIDKGLSEREQLQIRYQALHHQFVASAIATKQLHQI
DPNAKIGSMLARMQTYPATPKPEDVRAAQLEDEKNLFFTDVQARGEYPEYMNRFFSENGI
VIHMAEDDQAILLENPVDFISFSYYMTNVTQHNQVDDGVGNMAVGGRNPYLKESDWGWQI
DPVGLRITLNAMWDRYRKPLFIVENGLGALDKLEDDGHVHDQYRIDYLRAHIEQMKEAIK
DGVNLLGYTMWGPIDLISFSTSEMSKRYGFIYVDQDDDGKGTLKRIKKDSFTWYKEVIAS
NGETL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaacaacttatgaaaactcatttcccaaaggattcttatggggtggtgcgact
gcggctaatcaaattgaaggtgcttggaaccttgatggcaaagggttaagtacggctgag
gttgtccaaaaggctgatgatcgtcgtaaaatgtctatgggtgacgtcactgaagaaacg
cttgcaatagcattggctgataaaacagatgatttatatcctaagcgacgtggtgttgat
ttttatcatcactataaagaagatattgcgctttttgcggaaatgggatttaaagtgtat
cgcttctcgattgcatggtctcgaattttcccacaaggagaagatgcacaaccaaacgaa
gcaggtttggtattttacgacaatgtattagccgaattagccaaatatgatattgtgcca
ctagtgacgttgtcacactatgagatgccagttgttttgacacagaaatataatggttgg
gctgggcgcgaaacaattgctgcatttaatcgttttactgagacagtattcaaccgttat
catgatcaagttgattattggttgacatttaatgaaatcaatacaggtacctggggattt
cacgaaacgggggccattgataaaggcctttcggaaagagaacagttacagattcgttat
caagcgttacatcaccaatttgtcgccagcgctattgcaacaaagcaattgcatcagatt
gatccaaatgccaaaattggatcaatgttggcacggatgcagacgtatcctgcgacacca
aagccagaggatgtcagagcggcacaattagaagatgaaaaaaatctgttttttacagat
gtacaagcacgtggcgagtatccagaatatatgaaccgttttttcagtgaaaacggcatt
gtgattcacatggcagaagatgaccaagctattttgcttgaaaatccagtagactttatt
agttttagctactatatgactaatgtgacacagcataatcaggttgatgatggtgtgggt
aacatggccgttggcgggcgtaatccttatttgaaggaatcagattggggatggcaaatt
gatcccgttggattacggataactttaaatgcgatgtgggaccgttaccgcaaaccacta
tttattgtcgaaaatggcctaggtgctttagataaacttgaagatgatggtcatgtgcat
gatcagtatcgtattgattatttacgtgcacatattgagcaaatgaaggaagcaatcaag
gatggtgttaatctcttaggttatacgatgtgggggccaattgatttgattagtttttcg
acatcagaaatgtcaaaacgatatggtttcatttatgttgatcaagatgatgatggcaag
ggcactttgaaaagaattaaaaaagattccttcacgtggtacaaagaggttattgcctcc
aatggtgaaacactctaa

DBGET integrated database retrieval system