KEGG   Leuconostoc sp. C2: LGMK_09000Help
Entry
LGMK_09000        CDS       T01567                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lec  Leuconostoc sp. C2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LGMK_09000
Enzymes [BR:lec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LGMK_09000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1803423..1804361)
Genome map
AA seq 312 aa AA seqDB search
MKNKVVVIGSLNMDTIQMIDRLPQRGETLAVRNQASTFGGKGANQAVAAARQGADVTFIG
AVGNDDRGRAFKQLLVDEGIKTDYIFTKNQPTGSATIMLEDDGHNTIMVFGGANMSLSAD
DISQARAAIVAADVVVAQLEVPMAAVAKGFEIAREAGVLTILNPAPVTSHLTDEIMLTTD
LLIPNETEAAALADVQSTTDSQALEQLTLKLRRLGMAHTIVTLGGDGVYYHVNDQSGQVP
IFKVDAVDTTAAGDTFIGTVAANITKEMTDLPTIIKRSCFASSLTVSRRGALVSIPTKAE
VDAGLQQYSMVK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaagttgtcgtgattggtagtcttaatatggacacaatccaaatgattgat
cggctaccacaacgtggtgagacgcttgctgttagaaatcaggcaagtacttttggtggt
aaaggcgctaatcaggcggtggccgctgcgcgtcaaggtgcagacgtcacgtttattggt
gctgttggtaatgacgaccgtggccgtgcatttaaacaattgttggtcgacgagggcatc
aaaacagattacattttcactaaaaatcaaccaaccggttctgcaaccattatgttggaa
gatgatgggcacaatacgattatggtatttggtggtgccaacatgtcattgagtgcagat
gatatttcacaagcgcgtgcagcaattgttgcggcagacgttgttgtggcacaactagaa
gtacctatggcagctgtagcaaagggatttgaaattgcacgtgaggctggtgtgttaacc
attttgaatccagcgccggtaacatcacatttgactgatgaaatcatgttaacgactgat
ttattaatcccaaacgaaactgaagcggcagcgttagctgatgttcaatcaacaacagat
agccaagctctagagcagttaacactaaaattacgacgcttgggcatggcacatacaatt
gttacccttggcggggatggtgtgtactatcatgttaatgaccagagcggtcaggtacca
atttttaaagtagatgcggtagatacgacagctgcaggtgatacatttattggtacagtg
gcagcgaatatcacgaaagaaatgactgatttgccaacaattattaaacgtagttgcttt
gcgagttcattaactgttagccgtcgcggtgcacttgtctctattccaacgaaggcagaa
gtagatgcgggtctgcaacaatacagcatggtgaagtga

DBGET integrated database retrieval system