KEGG   Leuconostoc sp. C2: LGMK_09080Help
Entry
LGMK_09080        CDS       T01567                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00010  Glycolysis / Gluconeogenesis
lec00052  Galactose metabolism
lec01100  Metabolic pathways
lec01110  Biosynthesis of secondary metabolites
lec01120  Microbial metabolism in diverse environments
lec01130  Biosynthesis of antibiotics
Module
lec_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGMK_09080
   00052 Galactose metabolism
    LGMK_09080
Enzymes [BR:lec01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LGMK_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEJ31865
Position
complement(1818528..1819562)
Genome map
AA seq 344 aa AA seqDB search
MKITESSFGGSAKQYTLENNHGVRLSVTNFGARIVRLQVPVAGVYRDLVLGFDSMAEYLD
KDHFMGATIGRVAGRIAAGQFNLNGKDYQISINENGNTLHGGPDSFETKIWQVKKQVTDD
LVSVSFTYDSLNHENGFPGNLHVTVTYSLNNDNDWMLTYQALSDMSTLFNPTNHVYFNLD
GSPSKSVEDHSLQIIADHYAPLDNDRLTTGKKEHVENSAFDFRKLKKLKEVFTSRNAQNK
LVDGLDHPFFLNAKNDQSSNAKLVSSDEKVSVNLTTSSPAVVIFTANFGNDFSAPMRGTV
FNNHGGITLETQVAPGAERYPEFGDMICHSDKVYREQTVFELSF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattactgagagtagctttggtggatcagcaaaacaatatactttggaaaataac
catggtgtgcgattgagcgtgactaattttggtgctagaattgtccgtttacaagtgcca
gtagctggtgtttatcgagatttagttttgggatttgattctatggcagaatacctcgat
aaagatcatttcatgggcgcaaccattggccgtgttgctggcagaattgcagcaggacag
tttaatcttaatgggaaagattatcaaatcagtataaatgagaacggcaatacattgcat
ggcggcccagacagttttgaaaccaagatatggcaagtgaagaagcaggtcactgatgac
ttggtgtcagtgtcgtttacttatgatagtttaaatcatgaaaatggctttccaggtaat
ttgcatgtgacagtgacctatagtttgaataatgacaatgattggatgttaacataccaa
gcattaagtgatatgtcgacattgtttaatcccacgaatcatgtctattttaatttggat
ggtagtccgtcaaaaagtgttgaggatcatagtttacaaattatagctgaccattatgca
ccattggataatgatcgtttaacaaccggaaaaaaagagcacgttgaaaatagtgcgttt
gattttaggaagctaaagaagctaaaagaagtgttcacttcgaggaatgctcagaataag
ttggtagatggtttggaccaccccttcttcttaaatgcaaaaaatgatcaaagtagcaac
gccaaattagtatctagcgatgaaaaagtatctgttaatttaacgactagctcacctgca
gttgttatatttactgctaattttggtaatgattttagtgcccctatgcgagggacagtg
tttaataatcatggtggtatcactttggagacacaagttgcaccaggtgctgaacgctat
ccagaatttggcgatatgatatgtcatagtgataaggtctatcgggaacagactgtattt
gagttatcattttaa

DBGET integrated database retrieval system