KEGG   Leclercia sp. LSNIH3: C3F35_24035Help
Entry
C3F35_24035       CDS       T05316                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
leh  Leclercia sp. LSNIH3
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:leh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    C3F35_24035
   00500 Starch and sucrose metabolism
    C3F35_24035
Enzymes [BR:leh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     C3F35_24035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
pLEC-5e18:74348..75748
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVIQGQPRALADSHYPRWHLAPVTGLMNDPNGFVEFAGRYHLFYQWNP
LACDHTFKCWAHWSSPDLLHWQHEPIALMPDEEYDRNGCYSGSAVDNNGTLTLCYTGNVK
FADGGRTAWQCLARESADGTFRKIGPVLPLPEGYTGHVRDPKVWRHEDLWYMVLGAQDRQ
KRGKVLLFSSADLHQWTSMSEIAGHGINGLDDVGYMWECPDLFPLGDQHILICCPQGIAR
EEKCYLNTYPAVWMAGEFDYASGAFSHGELHELDAGFEFYAPQTMLTSDGRRLLVGWMGV
PEGEEMLQPTLINGWIHQMTCLRELEFINGQLYQRPLRELSALRGEANGWSGNALPLAPM
EIDLQTRGDDMLSLDFGGVLTLECDASGLRLARRSLASDEMHYRYWRGNVRSLRVFIDQS
SVEIFINGGEGVMSSRYFPACSGQLTFSGITPDAFCYWPLRTCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttccatcacgactgcctgcgattttgcaggccgtaatacagggccagccacgt
gcgctggccgatagccactatccgcgctggcaccttgcgccggtcaccgggctgatgaac
gaccccaacggctttgtcgaatttgccggacgctatcacttgttttatcagtggaacccg
ctcgcctgcgatcatacgtttaagtgctgggcgcactggagctcccccgatctgctgcac
tggcagcatgagcccattgcgctgatgccggacgaagagtatgaccgtaacggctgctac
tccggcagcgcggtggataacaacggtacgcttaccctgtgctataccggcaacgtgaag
tttgccgacggagggcgaaccgcctggcaatgcctggcaagggaaagcgccgacggcacc
ttccgcaaaatcggcccggtcctgccgctgccggagggctacaccggccacgtgcgcgac
ccaaaagtctggcgacacgaagacctgtggtacatggtgctgggtgcgcaggatcggcaa
aagcgcggcaaggtgctgctgttcagctctgcggatctccatcagtggacgagtatgagt
gaaatcgccggccacggcatcaatggcctcgacgacgtcggctatatgtgggagtgtccg
gatctttttcctctcggcgaccagcatattctaatctgctgtccgcaggggattgcccgc
gaggaaaagtgttacctgaacacctacccggcagtatggatggcgggcgagtttgattac
gctagtggcgctttcagccatggcgaactgcacgaactggacgccggctttgagttctac
gccccgcaaaccatgcttaccagtgatggccgtcgtctgctggtcggctggatgggcgtg
ccggagggcgaagagatgcttcagccgaccctcatcaacggctggatccatcagatgacc
tgcctgcgtgagctggagtttatcaacggtcagctctatcagcgtccgctacgggaactg
agcgccctgcgcggtgaagcgaacggctggtcggggaacgccctgccgctggcaccgatg
gaaatcgatttgcaaacccgcggggacgatatgttgagcctcgattttggcggcgtatta
acccttgagtgcgatgccagcggactccgcctggcccgacgcagtctcgccagcgacgag
atgcattatcgttactggcgcggaaacgtccgctcgctgcgtgttttcatcgaccagtcg
agcgtggagattttcataaacggcggtgaaggggtgatgagcagccgctacttcccggcc
tgctccggtcagctaacattctccggcatcacgccggacgcattctgctactggccgctg
cgaacttgcatggtagaataa

DBGET integrated database retrieval system