KEGG   Leclercia sp. LSNIH1: C2U54_24750Help
Entry
C2U54_24750       CDS       T05297                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lei  Leclercia sp. LSNIH1
Pathway
lei00052  Galactose metabolism
lei00500  Starch and sucrose metabolism
lei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lei00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    C2U54_24750
   00500 Starch and sucrose metabolism
    C2U54_24750
Enzymes [BR:lei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     C2U54_24750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AUU87170
UniProt: A0A2I8NZL9
Position
pLEC-000f:60320..61720
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVIQGQPRALADSHYPRWHLAPVTGLMNDPNGFVEFAGRYHLFYQWNP
LACDHTFKCWAHWSSPDLLHWQHEPIALMPDEEYDRNGCYSGSAVDNNGTLTLCYTGNVK
FADGGRTAWQCLARESADGTFRKIGPVLPLPEGYTGHVRDPKVWRHEDLWYMVLGAQDRQ
KRGKVLLFSSADLHQWTSMSEIAGHGINGLDDVGYMWECPDLFPLGDQHILICCPQGIAR
EEKCYLNTYPAVWMAGEFDYASGAFSHGELHELDAGFEFYAPQTMLTSDGRRLLVGWMGV
PEGEEMLQPTLINGWIHQMTCLRELEFINGQLYQRPLRELSALRGEANGWSGNALPLAPM
EIDLQTRGDDMLSLDFGGVLTLECDASGLRLARRSLASDEMHYRYWRGNVRSLRVFIDQS
SVEIFINGGEGVMSSRYFPACSGQLTFSGITPDAFCYWPLRTCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttccatcacgactgcctgcgattttgcaggccgtaatacagggccagccacgt
gcgctggccgatagccactatccgcgctggcaccttgcgccggtcaccgggctgatgaac
gaccccaacggctttgtcgaatttgccggacgctatcacttgttttatcagtggaacccg
ctcgcctgcgatcatacgtttaagtgctgggcgcactggagctcccccgatctgctgcac
tggcagcatgagcccattgcgctgatgccggacgaagagtatgaccgtaacggctgctac
tccggcagcgcggtggataacaacggtacgcttaccctgtgctataccggcaacgtgaag
tttgccgacggagggcgaaccgcctggcaatgcctggcaagggaaagcgccgacggcacc
ttccgcaaaatcggcccggtcctgccgctgccggagggctacaccggccacgtgcgcgac
ccaaaagtctggcgacacgaagacctgtggtacatggtgctgggtgcgcaggatcggcaa
aagcgcggcaaggtgctgctgttcagctctgcggatctccatcagtggacgagtatgagt
gaaatcgccggccacggcatcaatggcctcgacgacgtcggctatatgtgggagtgtccg
gatctttttcctctcggcgaccagcatattctaatctgctgtccgcaggggattgcccgc
gaggaaaagtgttacctgaacacctacccggcagtatggatggcgggcgagtttgattac
gctagtggcgctttcagccatggcgaactgcacgaactggacgccggctttgagttctac
gccccgcaaaccatgcttaccagtgatggccgtcgtctgctggtcggctggatgggcgtg
ccggagggcgaagagatgcttcagccgaccctcatcaacggctggatccatcagatgacc
tgcctgcgtgagctggagtttatcaacggtcagctctatcagcgtccgctacgggaactg
agcgccctgcgcggtgaagcgaacggctggtcggggaacgccctgccgctggcaccgatg
gaaatcgatttgcaaacccgcggggacgatatgttgagcctcgattttggcggcgtatta
acccttgagtgcgatgccagcggactccgcctggcccgacgcagtctcgccagcgacgag
atgcattatcgttactggcgcggaaacgtccgctcgctgcgtgttttcatcgaccagtcg
agcgtggagattttcataaacggcggtgaaggggtgatgagcagccgctacttcccggcc
tgctccggtcagctaacattctccggcatcacgccggacgcattctgctactggccgctg
cgaacttgcatggtagaataa

DBGET integrated database retrieval system