KEGG   Lodderomyces elongisporus: LELG_00002Help
Entry
LELG_00002        CDS       T01116                                 

Definition
mitogen-activated protein kinase MKC1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
lel  Lodderomyces elongisporus
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:lel00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    LELG_00002
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LELG_00002
Protein kinases [BR:lel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   LELG_00002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 552 aa AA seqDB search
MNEESPVYYGRTVNKVYNQEFIIDRRFKIIKELGHGAYGIVCSAKYDDGSTDSSTASASS
AGDGSNLSSSADGSYVAIKKITNIFSKKILCKRALREIKLLQFFRGHKNITCLYDLDIIP
NPLTGEFNEIYVYEELMECDMHQIIRSGQPLTDLHYQSFIYQILCGLKYIHSADVLHRDL
KPGNLLVNADCELKIGDFGLARGFSEDPEQNQGFMTEYVATRWYRAPEIMLSFSNYTKAI
DVWSVGCILAELLGGKPLFRGKDYVDQLNQILMILGTPPEDTLVKIGSQRAQNYVRSLPY
MKKISYSQLFPNANPLALDLLEKMLTLDPHERISVNDALNHKYLEIWHDPRDEPECQIKF
DFKSFETFEELDDMKQLIMEEVKGFREFVRKPIEEQQQIQLQYQMKQKQRQEEERKQSQR
FRNQETQPSYSNVSIDVNNSNQSRGRDGYEQAERREEDAYPRPQELTDFSFSNLELAGIA
SGGSGSGLGSGIGGINHHQNHSNLNNNQYDLRMHDEYDQGDFEFNPSVLGADYYKLEEDL
GFGLDGNTLDFN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagaaagccctgtttattatggccgcacagtcaacaaagtatacaatcaagaa
tttataatcgaccgccgattcaaaatcatcaaggaactaggccacggagcttacggtata
gtgtgctctgctaaatacgatgacggatcaacagactcttcaacagcctcggctagcagc
gcaggtgatggcagcaacttgtcatcttctgcagatggctcctatgtcgccataaaaaag
atcaccaatatctttagtaaaaaaatcctatgcaaacgagcattgcgagaaattaaactc
ctacaattctttagaggccacaagaacatcacttgtttgtatgacttggacattatccct
aacccattaacaggagagtttaatgaaatttacgtttacgaggaattgatggaatgcgat
atgcaccagatcatcagatcgggacaaccattaacagatctgcactatcaatcattcatc
taccagatcttgtgtggactcaaatatatacactcggccgatgtgctacacagggacttg
aagccgggtaacttattggtgaatgccgattgcgagttaaaaatcggtgatttcggtctt
gcaagagggttttccgaagaccctgaacagaatcaaggatttatgacagagtatgttgct
acacggtggtatagagcacccgagattatgttgagctttagcaattacaccaaggcaatc
gatgtatggtcagtaggatgtatactcgccgagcttttgggcggtaagccattgtttaga
ggcaaagactatgtcgaccagttgaatcaaatattgatgattttgggtacacctccagaa
gatactttggtcaaaattggttcacaaagggcacagaattatgtgcgctcgttgccatac
atgaaaaagattagctattcacaattgtttcctaatgccaacccactagccctcgattta
ttggaaaaaatgttaaccctagacccacatgaaagaataagtgttaatgatgcactaaac
cacaagtacctcgaaatatggcacgatccaagagatgaacccgagtgtcaaatcaagttt
gatttcaagagttttgaaacatttgaagaattggacgatatgaaacaattaataatggag
gaagtcaaaggctttagggaatttgtacggaaaccaattgaagaacaacaacaaatccaa
ttgcaatatcaaatgaaacaaaaacagcgacaagaagaggaaagaaaacaatctcaacga
tttagaaaccaagaaacgcaaccttcctatagtaatgtttcaatcgatgttaataactcg
aaccagtcgaggggaagagatggttatgaacaagcagagagacgagaggaagatgcatac
cctagaccacaggaattgactgacttttcattctccaacttagaactggctggtattgcc
agtggtggtagtggtagtggtcttggtagtggtatcgggggtattaatcatcatcaaaat
cattccaatctcaataacaatcaatatgacctgcgtatgcatgacgaatacgaccaagga
gatttcgagttcaatccttcggtattgggtgcagactactacaagttagaagaagatctc
gggtttggtcttgatggaaatactcttgactttaattag

DBGET integrated database retrieval system