KEGG   Lodderomyces elongisporus: LELG_00043Help
Entry
LELG_00043        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
lel  Lodderomyces elongisporus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LELG_00043
Messenger RNA biogenesis [BR:lel03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     LELG_00043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1887 aa AA seqDB search
MSFQWSPETFAEIYNAIKFQPDLDLSTIDLESINNDLLHVLITPLPLQESRSKLEKPVKF
SNGDEVQLNQPFVETSVVLATELDLDEVCTAELLFNAQELSFKKGTLLTDSAKLSYYLRY
EYILNILGYLINQKVLNLNVEQVFDNAIASFKKIYTLIGKLNDAIDKEKVTGDVNNLVFI
NAINFAKRQLFKCHELLGLILFGLSQLYFDKIGKLKNFQAVIDVAKSLDNNDILLIHFIP
FVLNFYKMSTDNSTLMNELYSQITKRIPLEKSETYDLSQTKIKAFEILIDFVFFTEFIPW
CKAQNSSKYTFQDSIIKYMEQLIGYGAMEILLNFCAETANNETQQVFELSHTYDFRSLLQ
RNFPHLEPTKFVYPGTPELLNAARQRPDMSTNILKLTDVSFLKLDPNLNDSLISPLFQTF
FSSFISNAALILTSLRDSEEDFVLSFQDRHHTEEEEEEEEEEEQNQEGGDGTGAREKEGK
GAAGKNNNYPERQFEETSDGNNSDNDRENGKHKSKKSSLLEFDQIAQRADLERFYLAFAY
NFNNRPELCSEFWNDEEMLDVIIGFLSWGLSNNTSPLIVASFCALLASLTSGGSHMATRI
WDILIHNSLSMKKNDFSRISIDSIHDSLAYYIDSLKTNFDEDLAEQVLVLQKKHEFMFTS
KPPVDVDGSGQNHIIIELAEDSIVSIAGFTHLLSSIIKNLSDNSPRDREIRKVAFQRFMP
IIGQFMTLDNLINGGKILQVNINAGTSSSPKYIDLPEIHVSNDSRVILLNLVFRLLGNFA
DNHNNDDAFMRYEIWRLLDRWMYHGLHLAPTPGQDKSNDVFGKEIDSRKYTRKRSLGMIE
VFSHNLTHYSEILNFTDLVKRLLGQLGGESAFDKYTLAYPCDLGFGYRPNNQIGVWPYMQ
FILLEVFAKSNDLTNLNDRIALQSILLSTCIDSLSEVDWRFLSHTALKVIRDFKSFETIF
DSLMPGIAINYDAFVKLHHSLAIICYFFDAKAYKALLRVIDIGVDAVNSSPEVGQLVGLA
LELFSKLLDIQKTYQLYLLPVLKSRSIVAQPVHRNSILTIGGTSTSLVLSLAQNQQLISL
QTIFENIYLAKSLGSQGVNSFYEILLFHIHSIVHIALFVNCENSISKNALKILKGITESA
QFSRAARSNTDPLINNDRLLTTFQNIDESEKLKFAFIDKFEEVEDSLDMKFDILELISSI
LDQSKNSVNVAHLLLGYEIKGYRLFWKNDSVHSTFLEVLLNTLSVSLTLISELDYNNGNR
HLIDVGPAKLSSLILQILIKLCKSPVSASLTTSLIRNYDSLVNKLIISQPKLDLLTIWGS
SGSEFNGDLSTDIENKFINSILSIDAFISFIKQRELALELLSIEYYSADSADKKKNYTSL
LMDKNEFPSSSAKILDFLDVLNYIFKNFNITKYDSLNRKFDMNLILEEVDESDYRLNYSV
LRNTFRILCQGSTLFTPEAKQSFSEELMVQGNKIHEFVTKYLVMTNTRDVQFNCLVSWCL
LVKILIIEDQIQSSDLIIEIFNSILPKVLEYLESDVAFSEELVSLCVSLFEVYCKKFCSL
KKGALEKATMLSKILPLLQTSINGISSSYSTPNFRAVLYSVFNKFLLESFDSSSLSIKIV
KQIKAAGSKLIPTICNDLSYSEGLARINAIFALEAMLRLGISTKTDSINESMTQTNFLSQ
MLRSIRRTDQVIHLASRGESHFSFNELFVDLTAFKATLYLLIKLAQTKLGALQILQNELF
STLRSLKLLQIDPDLGLNLFVSETREVKSMTIKVLLDTPLSLTDLVNTEKNKEGDENTIS
YFDLVIPIFELISTILVTMGPNYKPAIIETNLLMKENVRQLVIGVLKREYLLDSNQVSKE
IYEKDNHEINLLKKLVHSFTVINSLAA
NT seq 5664 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcaatggtcacccgagacgtttgcagagatttataatgccatcaagtttcaa
ccagacctcgacttgtctacaatagatcttgagtcgatcaacaatgatcttcttcacgta
ctcattacgccattaccactgcaagaatcgagatcaaaactagagaagccagttaagttt
agcaatggcgacgaagtccagctcaaccagccatttgttgaaacaagtgttgtattggct
acagaattggatttggatgaagtatgcacagcagaattgttgtttaatgcacaagagttg
agttttaaaaaaggtactttgttgactgactcagcgaaattgagctattatctgcgatac
gaatacattttgaatatcttgggctacttgatcaaccagaaagtattgaacttgaatgta
gagcaagtgtttgataatgccattgctagtttcaagaaaatttatacattgattggaaaa
ttaaatgatgcaattgataaagaaaaagttactggggacgtaaacaatttggtctttata
aatgcaatcaactttgcaaaaagacaattgttcaagtgtcacgaactattgggcttgatc
ttgtttggtttgagtcaactgtatttcgacaagattgggaaattgaaaaacttccaagca
gtgattgatgtagccaaaagcttggacaataacgatatattactcatccatttcatccca
tttgtattgaatttttacaaaatgtcaactgataacagcacgcttatgaatgagctctat
agccaaattactaaaagaataccgttggaaaaaagcgagacttatgacttgtcacaaaca
aaaatcaaggcctttgagatacttatcgattttgtattctttacagagttcattccctgg
tgtaaagcccaaaattcttcaaagtatacatttcaagatagtatcatcaaatacatggaa
caattaattggctatggtgcaatggagatactactcaatttttgtgcagaaacagcaaat
aatgaaacacaacaagtatttgaactttctcatacttatgatttccgatctttattacaa
agaaactttccgcatttagagccaacaaagtttgtatatcctggcacccccgagctttta
aatgcagcacgacaaagaccagatatgagtaccaacattcttaagctcaccgatgtttcg
tttttaaaacttgatccgaatttgaatgactcattaatttcgccgcttttccaaactttt
tttagttctttcatatccaatgcagcacttatcttaacttctcttcgagacagtgaagaa
gactttgtcctttcatttcaagatcgacaccatacagaagaagaagaagaagaagaagaa
gaggaagaacaaaatcaagaaggtggagatggtacaggagcaagagaaaaggaagggaaa
ggagcagctgggaaaaacaacaattatcctgaaaggcaatttgaggaaacgagtgatggc
aacaatagtgacaatgaccgagaaaatggtaaacataaatctaaaaagtcatcactactg
gagtttgaccaaatagcacaacgagcagatttggaacgcttctatttggcgtttgcatat
aactttaacaatagacctgagctttgctccgagttttggaatgatgaggaaatgctggat
gtgattataggttttttgtcgtggggattatccaataatacgtcgcccttgattgttgca
tctttctgtgctctcctagcatccttgacatccggaggttcgcatatggcaacaaggatc
tgggatatcctaattcataatagtttaagcatgaaaaaaaatgatttttcaaggatttcg
attgactcgatccatgactcgcttgcttattatattgactcattaaagacaaattttgat
gaggacttggcagaacaagtgctggtgttgcaaaaaaagcacgagtttatgtttactagc
aaacccccagttgatgttgatggttccgggcagaatcacatcataattgagttggccgaa
gattccattgtttctattgcgggttttacacaccttttgtcatcaattatcaaaaatctt
tccgataattcaccacgtgacagggaaattcgcaaagttgccttccaaaggtttatgcct
ataattggccaatttatgacattggataatttgatcaatgggggcaaaatcttgcaagtg
aatattaatgctggtacttcaagcagtcccaaatacattgacttgcctgaaattcatgtc
agcaatgattcaagagtaattctactcaacttggttttccgccttttgggcaattttgcc
gataaccacaataatgatgatgcatttatgcgttatgagatttggaggctacttgaccgt
tggatgtatcacggtcttcatttggcgccaacaccaggccaagataaatcgaatgacgtg
tttggtaaggagattgatagtagaaagtatacaagaaagagatctttgggaatgattgaa
gtattttcacataacttgacacattacagtgagattttaaactttactgatctcgtgaaa
agattacttggacaattgggtggagaaagtgcgtttgacaaatatacactagcctatcca
tgtgatttagggtttggatacagaccaaataaccagatcggtgtatggccctatatgcag
tttattcttttggaggtgtttgccaaatccaatgacttgacaaatttaaatgacagaatt
gcattgcaaagtattctactctccacttgcattgattccttatctgaagttgattggagg
ttcttgagccatactgctttgaaagtgattagagatttcaagtcgtttgaaacaattttt
gactcattaatgccgggaatagcgataaactacgatgcttttgttaaattgcatcattcg
ttagctattatttgttacttctttgatgccaaagcttataaggcgttgcttagagttatt
gatattggggttgatgcggttaactcatctcccgaggtcggtcaattagtgggtttagcg
cttgagttgttttcaaaattattggacattcaaaaaacatatcaactgtacttacttcca
gtgctcaaaagcagaagtattgtagcacagcccgtgcatagaaactcaatcctgacgatt
ggcggtacttctacaagcttagtattgagcctggcacagaatcaacaattaatatcactg
caaactatatttgagaatatataccttgcaaaaagcttaggctctcaaggagtgaactcc
ttttatgaaattttgttatttcacatacactcgattgtgcacattgctttgtttgttaat
tgtgaaaactcaatctccaaaaatgctttaaagatcctcaagggtatcacagaatctgcc
caatttagtcgtgctgctagatcaaataccgatccattgattaacaatgatcgtttactc
actacatttcaaaacattgatgaatctgaaaagctcaagtttgcatttattgataaattc
gaagaagttgaagatagccttgatatgaaatttgatatacttgagctcatctcgtcgata
ttggaccaatctaaaaattcggttaatgttgctcatttgctcttaggatacgaaattaaa
ggatatagacttttttggaagaatgattctgttcatagcacatttttggaagtgttactc
aatacattgagcgtcagtttgactttgatttcagaattggactacaacaatgggaataga
caccttattgatgttggtccagctaaactttcgtctttgattttgcaaattttgatcaag
ttatgcaaatcgccagtctcagcgtctttgacaacgtcattgattcgaaactatgatagt
ttggtaaacaaattgattatttcccaaccaaagctcgatctcttgacaatatggggttca
agtggttctgaattcaatggcgatttatctactgatatagagaacaaattcatcaattca
atactgagtatcgatgcctttatctcgtttatcaaacaacgtgagcttgcactcgagcta
ttatccattgagtattatagtgcggattcggcagataaaaagaaaaactacacatcgctt
cttatggacaagaatgagtttccttcatcctcagccaagatccttgatttcttggatgta
ttgaattacattttcaagaatttcaacattacaaagtacgacagcttgaatagaaaattt
gatatgaatcttatcttggaagaggttgatgaatcagattatcgtttaaactattcagtg
ttgagaaacacattcaggatcttatgtcaaggatcaacccttttcacacctgaggcaaag
caatcattttctgaggagttgatggtacagggtaataaaatacacgagtttgtgaccaag
tacttagtcatgacaaatacaagagatgttcagttcaattgtttagtatcttggtgtctg
ttggtcaagattctcattattgaagaccaaattcaatccagcgacttgattattgaaatc
ttcaattcaatattgcccaaagttttggaatatttggaatccgatgttgctttttcagaa
gagttagtttcattgtgtgtgtcattgtttgaagtttactgtaaaaagttttgctcattg
aaaaagggtgcacttgaaaaagcaaccatgttgtctaagatattaccattactccagact
agtataaatggtatctcgagctcatactccactcccaattttagagctgtgttgtactcg
gtgtttaacaagtttttgctcgaatcatttgatagctcctctctttcgattaaaattgtg
aaacagatcaaagctgctggcagtaagcttatacctaccatttgtaatgatttgtcatat
tcggaaggattagcgaggattaatgccatttttgcattggaagctatgcttaggttgggt
attagtacaaagactgattccataaacgaaagcatgacgcagacaaatttcttatctcag
atgctaagatctattagaagaacagatcaagtgatccacttggcctccagaggcgagtct
cactttagtttcaatgaattgtttgttgatttgactgcatttaaagcaacgctttacttg
ttgatcaagcttgcgcaaaccaaactgggtgccttgcagattcttcaaaatgaattgttt
tcaactcttagaagcttgaaacttttacagattgatcccgatttgggtttgaacttgttt
gttagcgagactagagaggtgaagagtatgaccataaaggttttgttggatactccgttg
tccttgactgacttggtcaatacagagaagaacaaagaaggtgatgaaaacaccatttcg
tattttgatttggttattcctatatttgagttgatatccacaatcttggtgaccatgggt
ccaaactataagcctgcaattatcgaaacaaacttgttgatgaaagagaatgtaaggcaa
ttggttataggagtattgaagcgagaatatttgcttgattctaatcaggttagtaaggag
atctacgagaaggataaccacgaaattaatctattgaagaaattggtccattcatttacg
gttatcaattctttggctgcttga

DBGET integrated database retrieval system