KEGG   Lodderomyces elongisporus: LELG_00096Help
Entry
LELG_00096        CDS       T01116                                 

Definition
(RefSeq) histone deacetylase RPD3
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lel  Lodderomyces elongisporus
Pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lel00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    LELG_00096
Enzymes [BR:lel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LELG_00096
Chromosome [BR:lel03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     LELG_00096
   HDAC complexes
    Sin3A-HDAC complex
     LELG_00096
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    LELG_00096
  Chromatin remodeling factors
   NuRD complex
    LELG_00096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 521 aa AA seqDB search
MYVELPFDELKVGTSKRRVAYFYDQDVGNYFYGTGHCMKPHRIRMTHSLIMNYELYKKME
IYRAEPATNLELTQFHSDEYIDFIDRVTPDNLHLFPREAQIFNVGEDCPVFDGLNEFCKI
SCGGSMEGAARLNNGDADVAINYAGGLHHAKKSEASGFCYTNDIVLAIIELLRKHPRVLY
IDTDVHHGDGVEEAFYTNDRVMTCSFHKFGEFFPGTGNVGDIGIGKGKYYSVNVPLRDGI
DDASYKSIFEPIILKIVEWYQPSAIVLQCGGDSLSGDRLGPFNLSMRGHANCVNFVRSLG
LPMMVLGGGGYTIRNVARTWAFETGICNGVLLPKELPYNGYYEYYAPTFELDVRSSNMNN
ANSKEYLDKILTQIVTNLDHTKHAPSVQMQDVPMDKEDLGDVYEDAAKAIDTKGGSQMQR
DKTIENGNEFYSDELKDVEERNIAVHDTSLASHNATSNQNNQAGNSGAMNGATDNTTDVQ
EVAAAESRKDNEHAAILFEEEKAEIDELNRVHDQQDQEMAD
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttgaactaccctttgatgaattaaaagtgggtacttcgaaacgacgggtagct
tacttttacgatcaggatgttggtaattacttctatggtactggacattgtatgaaacca
caccgaataagaatgacgcattcattgattatgaattacgaactatacaagaagatggag
atttatcgagctgagccagctacaaatttggagctcacccagttccatagcgacgagtat
atcgattttattgatcgtgttacgccagacaatctacacttgtttcctcgagaagcacag
atattcaatgttggagaggattgtccagtgtttgatgggttgaacgaattttgtaagata
tcgtgcggtggttcaatggaaggcgctgcaagattaaacaatggcgacgccgatgtggca
ataaattatgctggtggtttgcatcatgctaaaaagtcggaagcttcggggttttgctac
acaaatgatattgttctagcgattatcgaattgcttcgtaagcatccaagagtattgtac
atcgatactgatgttcaccatggtgatggtgttgaggaagctttctacacaaatgaccga
gtgatgacttgttcgttccataaatttggtgagtttttccccggtaccggtaatgtaggt
gatattggtataggtaaagggaagtactattcagttaatgtacccttgagagatggaatt
gatgatgcatcttataaatcaatatttgagcccataatactgaagattgttgagtggtac
cagccatcagctattgttttgcagtgtggaggtgactcattgagcggagacaggttgggt
cctttcaacttgtcaatgagaggacacgcaaattgtgtcaattttgtgcgttctttgggg
cttccaatgatggtacttggtggaggtgggtatactataagaaatgtagctcgaacatgg
gcatttgagactggtatttgcaatggtgtgcttttgccgaaggaactaccatacaatggc
tattatgagtattacgcgcccacgtttgaactcgatgttcgatcatcgaatatgaataat
gcaaactcaaaagagtacttggataagatacttactcaaattgtaaccaatctcgatcat
acgaagcatgcaccttcggtgcaaatgcaagatgtccccatggacaaggaagatcttggt
gatgtgtatgaagacgcggcaaaagcgattgacacaaaaggaggatcacaaatgcaaaga
gataaaacaattgaaaatggaaatgaattctacagcgatgagctgaaggatgtcgaggaa
cgcaacattgctgtgcatgatacgtctttggcgtcacacaatgcaacgtcgaatcagaat
aatcaagctggcaattctggtgctatgaatggtgccacggacaataccactgatgttcaa
gaagttgcagctgcagaatcccgtaaagacaatgaacatgcagctatattgtttgaagaa
gaaaaagcggaaatagacgaattgaatagggtccatgatcaacaagatcaggagatggca
gactaa

DBGET integrated database retrieval system