KEGG   Lodderomyces elongisporus: LELG_00122Help
Entry
LELG_00122        CDS       T01116                                 

Definition
(RefSeq) similar to SADH
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00010  Glycolysis / Gluconeogenesis
lel00071  Fatty acid degradation
lel00350  Tyrosine metabolism
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_00122
  Lipid metabolism
   00071 Fatty acid degradation
    LELG_00122
  Amino acid metabolism
   00350 Tyrosine metabolism
    LELG_00122
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LELG_00122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox 2-Hacid_dh_C ThiF NAD_binding_7 Pyr_redox_2 3HCDH_N XdhC_C FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 5234781
NCBI-ProteinID: XP_001527602
UniProt: A5DRY6
AA seq 371 aa AA seqDB search
MISILKRFVAKPISIASIAQKKTFTTSSITRNTCKMSIPTTQYGFVYNKSSGLTLNKSIP
VASAGVGQLLMKVDSVGLCHSDLHVIYEGLDCGDNYVMGHEIAGTVVDVGPEVDRWNVGD
RVAAVGPNGCGGCRACRDGIENVCKHSFGNWYGLGSDGGYQQYLLVQKPRNLVKIPDNVP
SDVAAASTDAVLTPYHAIKMAGVGPTSKVLIVGAGGLGCNAVQVAKAFGAHVTILDKKER
ARAEAVKFGADVAYESLPLGTEPGSFDACLDFVSVQATFDICQKFCAPKGCIIPAGLGAP
KLTLDLADLDLREIRILGTFWGTATDLEEVFDLVGKGLVKPMVRAAKLEELPDYIEKLRK
NEYEGRIVFNP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaatccttaaaagattcgttgcaaaacctatatcaatagcttcaattgctcaa
aaaaaaacatttactacttcatctataacgagaaatacttgcaaaatgtcaattccaact
acccaatatggttttgtttacaataagtcgtctggcttaacattgaacaagagtatacct
gttgcgtcggcaggtgtgggtcaattgcttatgaaggttgactctgttggattgtgccac
tcggacctccatgtgatttacgaaggtttggattgtggtgataactatgtcatgggccat
gagattgccggtaccgtggttgatgttggtccagaggttgatagatggaatgttggtgat
agagttgccgctgtgggtccaaatggttgtggtggttgcagagcctgtcgcgacggaatt
gaaaatgtatgtaaacactcttttggtaattggtatggcttgggctcagatggcggatac
caacaatatttgcttgtgcaaaaaccacgcaatttggttaagattcctgacaatgttcct
tcggatgtagctgcagcctcgactgacgctgtattgacaccataccacgcaatcaagatg
gctggtgtggggccaacatcaaaggtgctcattgttggcgcgggtggcttgggctgcaat
gccgtgcaagttgccaaggcatttggtgctcatgtcactattttggacaagaaggaacgc
gcgcgcgctgaagctgtcaagtttggtgccgacgttgcctatgagagtttaccactgggc
accgagccaggctcatttgatgcttgtttggattttgtttctgtgcaagcaacttttgac
atttgccaaaagttttgtgcaccaaaaggttgcatcatccccgcggggctcggtgcacca
aagttgacgcttgatttggcagatttggatttgcgcgagattcgtattttgggtactttt
tggggaaccgcgaccgatttggaggaggtgtttgacttggttggaaagggacttgttaag
cccatggttcgtgcagccaagttggaggaattgccagactatattgaaaagttgagaaag
aatgaatatgaaggtagaattgtctttaatccataa

DBGET integrated database retrieval system