KEGG   Lodderomyces elongisporus: LELG_00162Help
Entry
LELG_00162        CDS       T01116                                 

Definition
longevity-assurance protein 1
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
lel  Lodderomyces elongisporus
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LELG_00162
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     LELG_00162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 231 aa AA seqDB search
MFYYGISGPFGLWIMSKTPLWFFETTPFYLEYPHKTHEIFFKVFYLGQAAFWVQQSVVLI
LQLEKPRKDFKELVLHHIITIALIWCSYRFHFTWMGIAVFITMDVSDFFLAISKTLNYLD
SSLTGPFFVLFIGVWIYLRHYINLRILWSVLTEFRTVGEWELNWETQQYKCYISQPITFF
LIFALQLVNIYWLILILRILYRYIFSGDKKDERSDDEEEEEEVVEAEKKQQ
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgttttactatggtataagtggtccttttggattgtggatcatgtccaaaacaccatta
tggttctttgaaacgactccattctacctcgaatacccacacaagacccacgaaatcttt
ttcaaagtcttttaccttggtcaagctgcattttgggtgcaacagtccgttgtattaatc
ttgcaattggagaaaccaagaaaggactttaaggaattggtcttgcaccacatcatcacc
attgctttaatctggtgttcctacagattccatttcacttggatgggtattgcggttttt
atcaccatggatgtttctgacttttttttggcaatatcaaagactttaaactatttggat
tcaagcttaactggcccattttttgttttgtttattggtgtatggatatacttgagacac
tatatcaacctcagaatcttgtggtccgttttgaccgagtttagaaccgttggtgaatgg
gaacttaattgggagactcaacaatacaaatgctacatctcacaaccaattacattcttt
ttgatctttgccttgcaattggtcaatatctactggttgattttgattcttagaatcttg
tatagatatattttctcaggtgacaaaaaagatgaaagaagtgacgatgaagaagaagag
gaagaagtggttgaagctgaaaagaagcaacaatag

DBGET integrated database retrieval system