KEGG   Lodderomyces elongisporus: LELG_00172Help
Entry
LELG_00172        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
lel  Lodderomyces elongisporus
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:lel04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:lel04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:lel04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 707 aa AA seqDB search
MQPLSGYHDNQPDVLYLQQYLRSVILHSLDTFNYKNAEFACERLLALDQPLQSPAYSQHL
SSQLLLLLQQHQQQQQREQLQLQQRYNLESVYLYCLTLYRQNRIKSCYRKLVDASNKNIA
NHLNHLGCSWLYARCCLQLKKYKDGVDQLIRVRGLYDKERRFTIEERFEYEHSFGNNNGS
NGSGVNFNNSGGNISGNISVSGNGNGNANSNNNNDSFLKRRSLLSPDASTIYHLLGDLYA
ATGDVKNSALNYTQCLQLNQFDFEAFQKICKLGVDVRVKSLYKLQTHVSGSSSYGGYGGR
SGGVGGGDGAVLPSHQSFHNDVSAKNMATPYNSAGMQQAVSPPTRTPNIHVDEFNYSTPR
IITTLVPDAPLRKSNLNSGLHPNNDFANTTGNNTFEFAKPTLTTSSSSSSFFPDNKRRAS
RAYLKITSRLISQPHTNTHNHHIHHPTETPHKKGLKRNNSLDGANMSTSSTIAAASNVAG
TAAAAASASSASAAAPSSSSAIMKPASLPSISYIKELEKVKAYLLNKYLIFAKSFKCFTI
YDCYKAIKILEESISESDRNTPWVLSKLGRLHYEVAQYKQSEQYFERLRKIDRTRLEDME
YYSTLLWHLKKKIELTFLANELHDIDAHNAITWCVIGNLFSLNHETEEAIRCFNKAIKLN
DTFSYAYTLKGHELFSSDSYETALENFRLSLLHDSRHYNALYGIGMI
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctttgtctggttatcacgacaaccaaccggatgtgctttatttgcagcagtac
cttcgctccgttattctacattctctagatacattcaattacaagaatgcggagtttgcc
tgtgagagactccttgcactagatcaaccactgcaatcaccagcatactcccaacattta
tcatcacagctgctgctgctgctgcaacaacaccaacaacaacaacaacgagaacaacta
caactgcaacaacgttacaatttagaatccgtttatttgtattgtctaactttatatcgt
caaaacagaattaaatcttgttatcgtaagcttgttgatgccagcaacaaaaacatagca
aatcatttaaaccatttaggctgttcttggctttatgctcgttgttgtctacagttgaag
aaatacaaagatggagtagatcagttgattcgtgtgcgtggtctatatgacaaagaaaga
aggtttaccattgaagagcgatttgaatacgagcacagctttggcaacaataatggtagc
aatggcagtggtgttaatttcaataacagcggaggaaatataagcggaaacataagcgta
agcgggaacggaaacggaaacgcaaacagcaataataacaacgacagctttttaaaacgt
cgaagtttgcttagccctgatgcatctacgatctatcatttattaggtgacttgtacgct
gccacgggagatgtgaagaatagtgccctaaattacacacaatgtctacagttgaatcaa
tttgattttgaagcgtttcaaaagatctgcaagttgggagtcgatgtccgtgtgaagagc
ttgtacaagttgcaaacccatgtatccggcagtagtagttatggtggctatggtggtcgt
agcggtggtgttggtggtggcgatggagccgttctgccgtctcatcagtcgtttcataat
gatgtctctgccaaaaatatggctaccccatacaattccgcaggcatgcaacaagcggtg
agcccgcctacaaggacaccaaatatacatgttgacgagtttaattactcaacgccaaga
attattactacgctggtaccagatgctccgttgaggaaatcaaatctaaactccggatta
catccaaacaacgattttgcaaatacaacgggcaataacacatttgaattcgccaaaccc
accttaactacttcatcctcatcgtcttcgttcttccctgataataagaggcgtgctagt
cgtgcatacctgaaaattacgtcgcgtctaatctcgcaaccacatacaaatacacataac
catcacattcaccaccctacggaaactccacacaagaagggattgaaaagaaataactcc
ttagatggtgccaacatgtcaactagctctactattgccgctgcctctaatgtggctggc
acagcagcagctgcagcgtctgcatcgtctgcatctgcggctgcaccgtcatcgtcatca
gcaataatgaagccggcatcattaccatcaatctcatacatcaaggagcttgaaaaagtt
aaggcatacttattaaacaagtacctgatctttgccaagagcttcaaatgctttacaatt
tatgactgttataaagcaataaagattcttgaggagtcaattagtgaaagtgatagaaat
acaccatgggtgttgagtaagttggggagattgcactatgaagtggctcagtacaaacaa
tcagaacagtattttgaaagattacgaaaaatagatcgaacacgtttggaggatatggaa
tattactctactctattgtggcacttgaaaaagaaaattgaacttacttttcttgcaaat
gaactccatgatattgatgcgcataatgctataacttggtgcgtgattgggaatctattc
tctctcaaccacgaaaccgaagaagccataagatgtttcaacaaagccatcaaattgaac
gacacattttcctatgcatatacgctcaagggacatgagctattttcaagcgactcgtat
gagacagctttggagaatttccgattaagccttttacacgattcaagacactataatgca
ctctatggaattggtatgatctaa

DBGET integrated database retrieval system