KEGG   Lodderomyces elongisporus: LELG_00172Help
Entry
LELG_00172        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
lel  Lodderomyces elongisporus
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:lel00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    LELG_00172
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    LELG_00172
   04113 Meiosis - yeast
    LELG_00172
Protein phosphatases and associated proteins [BR:lel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     LELG_00172
Ubiquitin system [BR:lel04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     LELG_00172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 707 aa AA seqDB search
MQPLSGYHDNQPDVLYLQQYLRSVILHSLDTFNYKNAEFACERLLALDQPLQSPAYSQHL
SSQLLLLLQQHQQQQQREQLQLQQRYNLESVYLYCLTLYRQNRIKSCYRKLVDASNKNIA
NHLNHLGCSWLYARCCLQLKKYKDGVDQLIRVRGLYDKERRFTIEERFEYEHSFGNNNGS
NGSGVNFNNSGGNISGNISVSGNGNGNANSNNNNDSFLKRRSLLSPDASTIYHLLGDLYA
ATGDVKNSALNYTQCLQLNQFDFEAFQKICKLGVDVRVKSLYKLQTHVSGSSSYGGYGGR
SGGVGGGDGAVLPSHQSFHNDVSAKNMATPYNSAGMQQAVSPPTRTPNIHVDEFNYSTPR
IITTLVPDAPLRKSNLNSGLHPNNDFANTTGNNTFEFAKPTLTTSSSSSSFFPDNKRRAS
RAYLKITSRLISQPHTNTHNHHIHHPTETPHKKGLKRNNSLDGANMSTSSTIAAASNVAG
TAAAAASASSASAAAPSSSSAIMKPASLPSISYIKELEKVKAYLLNKYLIFAKSFKCFTI
YDCYKAIKILEESISESDRNTPWVLSKLGRLHYEVAQYKQSEQYFERLRKIDRTRLEDME
YYSTLLWHLKKKIELTFLANELHDIDAHNAITWCVIGNLFSLNHETEEAIRCFNKAIKLN
DTFSYAYTLKGHELFSSDSYETALENFRLSLLHDSRHYNALYGIGMI
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctttgtctggttatcacgacaaccaaccggatgtgctttatttgcagcagtac
cttcgctccgttattctacattctctagatacattcaattacaagaatgcggagtttgcc
tgtgagagactccttgcactagatcaaccactgcaatcaccagcatactcccaacattta
tcatcacagctgctgctgctgctgcaacaacaccaacaacaacaacaacgagaacaacta
caactgcaacaacgttacaatttagaatccgtttatttgtattgtctaactttatatcgt
caaaacagaattaaatcttgttatcgtaagcttgttgatgccagcaacaaaaacatagca
aatcatttaaaccatttaggctgttcttggctttatgctcgttgttgtctacagttgaag
aaatacaaagatggagtagatcagttgattcgtgtgcgtggtctatatgacaaagaaaga
aggtttaccattgaagagcgatttgaatacgagcacagctttggcaacaataatggtagc
aatggcagtggtgttaatttcaataacagcggaggaaatataagcggaaacataagcgta
agcgggaacggaaacggaaacgcaaacagcaataataacaacgacagctttttaaaacgt
cgaagtttgcttagccctgatgcatctacgatctatcatttattaggtgacttgtacgct
gccacgggagatgtgaagaatagtgccctaaattacacacaatgtctacagttgaatcaa
tttgattttgaagcgtttcaaaagatctgcaagttgggagtcgatgtccgtgtgaagagc
ttgtacaagttgcaaacccatgtatccggcagtagtagttatggtggctatggtggtcgt
agcggtggtgttggtggtggcgatggagccgttctgccgtctcatcagtcgtttcataat
gatgtctctgccaaaaatatggctaccccatacaattccgcaggcatgcaacaagcggtg
agcccgcctacaaggacaccaaatatacatgttgacgagtttaattactcaacgccaaga
attattactacgctggtaccagatgctccgttgaggaaatcaaatctaaactccggatta
catccaaacaacgattttgcaaatacaacgggcaataacacatttgaattcgccaaaccc
accttaactacttcatcctcatcgtcttcgttcttccctgataataagaggcgtgctagt
cgtgcatacctgaaaattacgtcgcgtctaatctcgcaaccacatacaaatacacataac
catcacattcaccaccctacggaaactccacacaagaagggattgaaaagaaataactcc
ttagatggtgccaacatgtcaactagctctactattgccgctgcctctaatgtggctggc
acagcagcagctgcagcgtctgcatcgtctgcatctgcggctgcaccgtcatcgtcatca
gcaataatgaagccggcatcattaccatcaatctcatacatcaaggagcttgaaaaagtt
aaggcatacttattaaacaagtacctgatctttgccaagagcttcaaatgctttacaatt
tatgactgttataaagcaataaagattcttgaggagtcaattagtgaaagtgatagaaat
acaccatgggtgttgagtaagttggggagattgcactatgaagtggctcagtacaaacaa
tcagaacagtattttgaaagattacgaaaaatagatcgaacacgtttggaggatatggaa
tattactctactctattgtggcacttgaaaaagaaaattgaacttacttttcttgcaaat
gaactccatgatattgatgcgcataatgctataacttggtgcgtgattgggaatctattc
tctctcaaccacgaaaccgaagaagccataagatgtttcaacaaagccatcaaattgaac
gacacattttcctatgcatatacgctcaagggacatgagctattttcaagcgactcgtat
gagacagctttggagaatttccgattaagccttttacacgattcaagacactataatgca
ctctatggaattggtatgatctaa

DBGET integrated database retrieval system