KEGG   Lodderomyces elongisporus: LELG_00331Help
Entry
LELG_00331        CDS       T01116                                 

Definition
similar to alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LELG_00331
Enzymes [BR:lel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LELG_00331
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LELG_00331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 510 aa AA seqDB search
MAFSFPKLSKISILVIALYLSFLDAVSAAPVDNSAETKKNIIFLVGDGLGPSGVNLARAY
RQYVDQLPYNDLLELDKYYIGTQGTSSNSSLITDSAAAGTALATGQKTYNGAISVDVDQH
ALGAVGEALKLQGYTTGLVVTTTVTDATPAVWYSHAISRSSQDLLAEQLVGEIHPLGFVP
SLILGGGRGWFYGVNEGGLRKDNRSLIEEVQNNGTWTYIGDRAGFDNLDEGKNVTLPLLG
LFDDESYPYRIDRDDEQHPNLVEQTRVALNALSNATRDSEQGFFLLIESSRIDHAGHAND
SPAHVHETLEYDETIAEVYKFVQNSDVDTIVIATADHETGGLTLKNTKGSDFSAIVNATH
STEYLADSIVDFDNFTDTDALQEFIRTTIIQDGLGLTNFTEDEVNRIADLVRDDGEVGEN
TDRGTILSVALSNLTASRAKTNWASTDHTWVDVGLYAFSNAPYLQQKVLNTKDGLAGFHQ
NTDFSVFIKAITDIDLKDTTEKIADIPLKY
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggccttctcatttccaaaactctccaagatctccatattggtaattgccctctactta
tcgtttttggatgctgtatctgctgcaccagttgacaattctgctgaaactaagaaaaac
atcatcttcctcgttggcgatggattggggccaagtggtgtcaatttagctcgtgcttat
agacaatacgttgatcaacttccatacaatgacttgttggaattggataaatattacatt
ggcacccagggcacatcctcaaacagttccttaattactgattcagcggccgctggtacc
gcattggcaacgggtcaaaagacttataatggtgccatttcggtcgatgttgatcaacat
gctctcggtgcagtgggcgaggcattgaaattgcaaggctataccactgggttagttgta
acaactactgttacagatgctactcctgcagtttggtattctcatgccatttcgagatca
tcgcaagacctcttggccgaacaattggttggtgagatccacccattgggattcgtgcca
tctttgattcttggtggtggcagaggctggttttatggtgtaaatgaaggtggattgaga
aaagataacagaagtttgatcgaggaggtgcaaaataacggaacttggacatatattgga
gaccgtgctggttttgataatttggacgagggaaaaaatgttaccttgccattattagga
ttgtttgatgacgaatcatacccatacaggattgatagagatgatgagcagcatcccaat
ttggttgagcaaactagagtagctttgaatgcattatcaaatgccactagggattcagaa
caaggttttttcttactcattgaatcctcaagaattgaccatgctggccatgccaatgac
tctcccgcacacgttcatgagactttagagtacgacgagacaattgccgaggtgtacaag
tttgttcaaaattctgacgttgatacgatagtcatcgctactgcggaccatgagaccggg
ggattaacattaaagaataccaagggaagtgacttttcagccattgttaatgccactcat
tcaactgagtatttggcagattcgattgttgattttgataactttacagatactgatgca
ttacaagagtttatcagaaccacaattatccaggatggtttggggttgacaaactttact
gaagatgaagtcaatagaattgcagacttggtaagagatgatggtgaggttggcgagaac
accgatagaggtactatcttgagtgtagcactctccaatttaactgcgtcaagagccaag
accaattgggcttcaactgaccatacatgggtcgatgttgggttatatgcattctcaaat
gcaccttatttgcagcaaaaagttttgaacactaaagacggtttagcaggattccatcaa
aacaccgacttcagtgtatttataaaggcaatcactgacattgacttgaaagatactaca
gaaaagattgcagatattccattaaagtattaa

DBGET integrated database retrieval system