KEGG   Lodderomyces elongisporus: LELG_00373Help
Entry
LELG_00373        CDS       T01116                                 

Definition
alcohol dehydrogenase 2
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LELG_00373
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_00373
  Lipid metabolism
   00071 Fatty acid degradation
    LELG_00373
  Amino acid metabolism
   00350 Tyrosine metabolism
    LELG_00373
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LELG_00373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 357 aa AA seqDB search
MNRFKIPTTQKAVIFSTLNGPLEYKSIPVPKPAPNQLLVNIHYSGVCHSDLHVYKGEFGK
TLPNLPLVGGHEGSGVVVGFGSNVTNWQIGDLVGVKLINHTCGTCEHCQQSQETACADSR
LSGVHINGTFQQYCIVDALQATKLPRDINLPAVGPILCAGITVYKGLKASLAKPGQWVVI
SGAAGGLGSLAVQYAKALGLRVIAIDGGGEPNEKEKFVKDLGAEVYIDFTKSADVVKEVH
QHSGSGGGAHAALNVSTSEAAIQQSINFVRSRGTVVLIGLPAEAKIKIPILPTVLRQITV
KGSYVGTNWDTHEAVDFFARGLIRCPIQIVGLSELERVFKLMEQGKIIGRYVVDTSK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacagatttaaaatcccaactactcaaaaagcagtaatcttttccactctaaatggt
ccactcgagtacaagtccattcccgtgcccaaacctgcgccaaaccagcttctcgtgaac
attcactactcgggagtttgccactctgacttgcacgtctacaaaggtgagtttggcaag
actttacctaatctcccactcgtaggtggccacgaaggttcgggagtcgttgttggattc
ggctcaaatgtcacaaactggcaaatcggtgaccttgtcggtgtcaaactcattaatcac
acgtgtggtacctgcgagcattgtcagcaatcacaagagactgcttgcgcagactctcgg
ctctcgggtgtgcatatcaatggcacattccagcaatactgcatcgttgacgccttacag
gcaacaaaattaccacgtgatataaatctacctgctgtgggaccaatattgtgtgcgggc
ataacggtatacaagggcttaaaagcatcactagcgaaacctggtcaatgggtcgttatt
tccggtgctgcaggaggattgggctcgcttgccgtgcaatatgcaaaagccttaggcttg
agagttattgcaatcgatggtggcggtgagccgaacgagaaggaaaagtttgttaaggat
ttaggggcagaagtatacattgatttcacaaaaagtgctgatgtcgtaaaggaagttcac
caacattcaggaagtggcggaggcgctcatgcagcattaaatgtctccacttctgaagct
gcaattcaacaaagcatcaactttgttagatctcgcggcacagtggtgcttattggttta
ccagcagaggccaagattaaaataccaatattgcccacagtattgagacaaatcaccgtg
aagggttcctatgtgggaacaaattgggatactcatgaagcagttgatttctttgcaaga
ggtttgatcagatgtcctatacaaatagttggcttgagtgagcttgaaagagttttcaaa
ttaatggaacaaggtaagattattggtcgatatgttgttgatacatccaagtaa

DBGET integrated database retrieval system