KEGG   Lodderomyces elongisporus: LELG_00380Help
Entry
LELG_00380        CDS       T01116                                 

Definition
lysophospholipase 3 precursor
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LELG_00380
Enzymes [BR:lel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LELG_00380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 739 aa AA seqDB search
MKLIHVLSIAATVMYPTTAFWPFDSGDSSSSSSATETTGDNSPTATSSGDGEAWYQTLLS
GFGIGGGDESGSSASGSATETGAAATDDSNPYAPYNATCPSGPLLREATKISDNEENYIE
KRHEITNENLISFLKRADISGFDPESFVNDNADEHNITIGLAFSGGGYRAMLCGAGQLLA
TDGRFPDSNDHGVGGLLQAATYLTGLSGGNWLVGSLVMNNWLSVGDIVNGTSDIWQLEDS
ILNPSGIRIDKTIAYYYGLRQAVLAKLGAGFDTSITDIWGRALSHQFFEDESGGENVTWS
SVRNMSHFEDHTMPYFLVVANGRQPNTLIINENSTVVEISAYELGSWDNSLKAFTDVEYL
GSSVDGGNPNNSNVCVKNFDNSGYIMGTSSSLFNQIVLQLGNYDINSVIKSILTDLLMDL
SYEQADIAAYSPNPFFGSPYGNSSDIANNDTLFLVDGGEDLQNVPFYPLIQNTRDVDVIF
AFDNSADTDDAWPNGTSIMETYKRQFSVQGKGTPFPFVPDVEGFLDENLHSKPVFFGCNA
SELDSLIAWHGNKDINSTDVPLVVYISNFNQSYFSNFSTFKLSYKDEEKWGTIQNGFEVM
SRNNLTDDSEWLTCVGCAIIRRQQERFGQEQSDDCKKCFDEYCWTGGPSKAAAVSSVGQL
SEITGINTDTSSTATSTATSGSGSGSGSGSGSGSGSGPSSSSSSSSTSSKHNEGLPLNAP
SSYILVIANLIFGAVIAYL
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaatccacgtgctaagcatagcggcgactgtaatgtaccctacaacagcattt
tggccctttgattcgggggattcatcttcttcatcgtcagccacagaaacaacgggggat
aactcgccaactgcaacctcatctggcgatggtgaagcatggtatcaaacattgttaagc
gggttcggcataggaggtggcgatgaaagtggaagtagtgctagcggctcagctacggaa
acaggcgcagcagctaccgatgactcaaacccatacgctccttacaatgcgacgtgccct
tctggtcctttacttagagaggctacaaagatctcagataacgaggaaaattacattgag
aaaagacatgaaattacgaatgaaaatttaataagcttcctcaaacgtgccgacatttcg
ggctttgatccggagtcatttgtcaatgataatgccgatgagcacaatatcacaataggc
ttagcgtttagtggaggtggatatagagcaatgctttgtggggcaggacagttactcgcc
acggatggtcgatttccagattccaacgaccacggggtcggtgggcttctacaggcagct
acgtacttgacgggtttatctggtggtaactggttagtagggagtttagtgatgaataat
tggctttctgtgggtgatatcgttaatggtacttcagacatttggcaacttgaagactcg
attttgaatcctagcggtattcgaattgacaaaaccatagcttactattatggcttgcga
caagcagtgttagcaaaactgggtgcgggatttgatacatcaatcaccgatatttggggt
agagcactttcgcatcaattttttgaagatgaaagtggcggtgaaaacgttacatggtcc
agtgtgcgtaatatgtcacactttgaggatcatacaatgccgtattttttggttgttgca
aatgggagacaacccaataccttgattataaatgagaatagtacggtggtggaaatttct
gcgtacgaattgggatcatgggacaattcattaaaagcgttcacagatgtggagtatttg
ggatccagtgttgatggcggcaacccaaacaattccaatgtttgcgtgaaaaactttgac
aattcaggctatattatgggcacatcatcatcattgttcaaccaaattgttcttcagttg
ggtaattatgatataaacagtgttatcaaatccattttgaccgatttgttgatggactta
agttacgagcaagctgatatagctgcatattcgccaaatccattttttgggtcaccatac
gggaactcatccgatatagccaacaatgataccttgtttttggtggatggtggagaagat
cttcaaaatgttccgttttatccattgatccaaaatactagagatgttgacgtaattttt
gcctttgacaattccgcagatactgatgatgcttggcccaatggaacatccattatggaa
acatacaaaagacagttttctgttcaagggaagggtacgcctttcccatttgttcctgat
gttgaaggttttcttgatgaaaatcttcattcgaaaccagtatttttcggttgcaatgct
tcggagttggatagtttgattgcatggcacggaaataaagacatcaattcaactgatgtg
ccactagttgtttacatttcaaactttaaccagtcgtatttttcgaacttttcaacattt
aagctttcctataaagatgaagagaaatggggcactatacaaaatggctttgaagtgatg
tcgaggaataatttgacagatgactcagagtggctcacttgtgtaggatgtgctattatc
agaagacagcaagaacgatttggccaggagcaaagtgatgattgtaaaaaatgctttgac
gagtattgctggactggaggcccatcaaaagcggctgctgtttcaagtgtaggccaattg
agcgaaattacaggaataaatactgatacgtcatctacagccacgagtaccgcaacctca
ggttcaggttcaggttcaggctcaggctcaggttcaggatcaggatcaggaccaagctct
tcatcgagctctagttctacttctagcaaacacaatgaaggattgccgctcaatgcccca
tcatcttatattttggtgatagctaatttgatttttggagccgttattgcatatttatag

DBGET integrated database retrieval system