KEGG   Lodderomyces elongisporus: LELG_00447Help
Entry
LELG_00447        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
lel  Lodderomyces elongisporus
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LELG_00447
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     LELG_00447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 649 aa AA seqDB search
MSSFGYYLSKPPYQIITHFFFTTVHFFKHWVLRFVGFFTNMSSEQLLYRQIDVVLATLSS
QGVVINNQQDPAIQLRKQSKSQLSSPTREHLGEAGRGRGEEEEEEESTNGGYFGGISSCI
GFGPSSVSSHHAPIPKFIAYKCILYVEQKNSTSEGHSDGSDEISITYVTPNHPEYSSKAT
KVTINTINVQIQNFKPLQPKFNGEAKNLVSHIMNKAYHYPVMQQPRVLVLINPHGGQGKG
TKIYNNHIKPILQAARCKITYQETKYSGHATDIARELKLSDYDVVVCCSGDGIPHEVING
LYQRPDKGLEAFNNLIITQLPCGSGNALSLSTLGGSKYPEIATWMMLKSKPSKMDLMAIT
QKTQDSPSGSTTKLSFLSQCYGIIADSDIGTEHLRWLGAIRFEIGVAQKVLTNATYPCDL
HVEFWTRDKTAIAQHVEQHLSQSDKKSKTKQKNNEKATGIKSTNVAAAHVNGSSSDDFNG
TTTTAEDHTSNSFLSQVTQENLQLCYPSLDQPLPLTWQTLPNLTTENLNILYVGKMPYVS
LDAQFFPAALPNDGYMDMIVTDTHTTSMLSLTSILLNVEQGKHIDDENVLHAKVKAYRCV
PRVSNRNKNHYISVDGESFPFEAFQVEILPRVMTGLLQDGKFTETLLTK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtctagttttggatactacttgtcaaaaccaccatatcaaatcatcacccactttttc
tttacaactgttcatttcttcaaacattgggttttgcggtttgttggattcttcacaaat
atgtcttcggagcaattactttatcgacaaattgacgttgtgctggctacattatcatca
caaggagtggttatcaataaccaacaagatccggctatacaactgcggaaacaaagcaag
tctcagctttcgtcacctacaagagagcatttaggagaagcaggaagaggaagaggtgaa
gaagaagaagaagaggaaagtacaaatggtggctattttggaggaatttctagctgcatt
ggttttggaccatcttcagtatccagtcatcatgccccaataccaaaatttattgcttac
aaatgcatattgtacgtggaacagaaaaattccactagcgaaggacacagcgatggatcg
gatgaaatttcaattacatatgtcacaccaaaccaccccgaatattccagcaaagccact
aaagtaacaatcaataccatcaatgtccagattcaaaatttcaagccgctgcaaccaaag
tttaatggtgaagccaaaaacttggtaagccatataatgaacaaagcttaccactaccca
gtaatgcaacagccacgcgtgctcgtactaatcaatccacacggtggccaaggaaaaggt
acaaaaatatacaataaccacattaaaccaattctacaagctgcacgatgtaaaataaca
taccaagaaacaaagtattcgggtcacgcaacagatattgcaagagaattaaaattgtca
gattacgatgttgttgtatgttgctctggtgacggtatcccgcatgaagtcatcaacgga
ctataccagcgtcccgataaaggactcgaagcctttaataaccttataattacgcagttg
ccctgtggatcaggcaatgcacttagtttaagcactctcggcggatcaaagtatcccgag
atagccacctggatgatgctcaagtcaaagccatccaaaatggacttgatggcaattact
caaaagacacaagacagcccatcaggctcgacaacaaaattatcatttctcagtcagtgt
tatggtattattgctgactctgatataggaaccgagcatttgcgatggcttggcgcaatt
agatttgagattggtgtggctcagaaagtattgaccaatgcaacctatccatgtgatttg
cacgttgagttttggacaagggataaaactgccattgctcagcatgttgagcaacacttg
tcacaatccgataagaagtcaaaaacaaaacaaaaaaataatgaaaaagcgacgggcatc
aagagcacaaacgttgccgcagcccatgtcaatggtagcagtagcgacgatttcaatggt
accacaaccactgcagaagatcacacaagcaatagttttctttctcaagtcacgcaagaa
aaccttcaactctgttatccgtcactcgaccagcctcttccgctgacgtggcagacacta
ccaaatttaactactgaaaacctcaatattttgtatgtgggtaagatgccctatgtatca
ctggatgcccaattcttccccgctgcacttccaaacgatggttatatggacatgattgtg
actgatacgcacacaacatcgatgttgagcctaacctcaatcctattaaatgttgaacaa
ggcaaacacattgatgatgagaatgtcctacacgcaaaagttaaggcttataggtgcgta
cctcgtgtgagtaacagaaataagaatcactacatatctgtggatggtgaaagctttccc
tttgaagcatttcaagtggagattttgcccagagttatgactggactactacaagatgga
aaatttacagaaacactgttgaccaagtga

DBGET integrated database retrieval system