KEGG   Lodderomyces elongisporus: LELG_00474Help
Entry
LELG_00474        CDS       T01116                                 

Definition
anthranilate synthase component II
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
lel  Lodderomyces elongisporus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lel01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lel00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 567 aa AA seqDB search
MLTLVLNHNQDESMTTISTKNTTKASTANASATAAVAGNAIVGTSAIKRHVLMIDNYDSF
TWNLYQYLHQSPRCGKVDVYRNDKIDIATIENKIKPDIIFISPGPGHPVTDSGISSDVIR
HFKGKLPIFGVCMGQECIFHVFGGDVSYAGEIVHGKTTTIKHDSKGMFEDIPQSVAVTRY
HSLAGSEKTLPECLEVTAVTETKPDVIMGVRHKKYTIEGVQFHPESILTESGQLMIDNLL
GIFGGTWEENEAYRMQAKKTRSANNFTKGENILKTIYDKRQEDYKVIENLPGRSFQNLEI
ALSLGAAPPVINFYERLKYTQDALKQTVILLEFKRASPSKGDINVSAHAGSQALTYAING
CSTISVLTEPNWFKGSLEDLSLIRQIIDGPKTKTIENYKRPAVLRKEFIFSKYQILEARL
AGADTVLLIVKMLNNQELLQELYSYSLELDMIPLVEVNDGPELEQALKLTYKGSTNEPLI
IGVNNRNLTNFDVDLGTTSLLVEHAKGSQNGRGGDVLILALSGITSVDDVKKYKYEDNVD
GFLIGESLMRAESKGQAGEFLHQLCNC
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgcttacattagttctcaaccacaaccaagacgagtcaatgacaacaatctcgacaaaa
aatacaaccaaagcgtcaactgcaaatgcatccgcaactgcagctgttgctggtaatgct
atagtggggacatcggcgatcaagagacatgtgcttatgattgataactacgattcattc
acctggaacttgtaccagtaccttcaccagtcgccaaggtgtggaaaagttgatgtttac
agaaatgataagatcgatattgcaaccattgaaaacaaaatcaagccagatatcatattc
atttcacctggtcccggccatcctgttacggattctggtatttccagtgatgtcattaga
cattttaaaggtaaattacccatttttggtgtttgtatgggtcaagagtgtatcttccat
gtctttggaggtgatgtttcctatgccggagagattgttcacggaaaaaccaccaccatt
aagcacgacagcaagggaatgtttgaggatataccacagtctgtagcggtaacaaggtac
cattctcttgcaggaagcgaaaagactttgccagagtgcttggaagtaacagcagttact
gaaacaaaacctgatgtgattatgggagtcagacacaagaagtatactatagaaggtgtg
cagttccaccctgaatctattttaacagaatctggccagcttatgattgacaatctattg
ggcatctttggcggcacctgggaagaaaacgaggcatatagaatgcaagcaaaaaagact
cgatctgctaataattttaccaagggcgagaacattttaaaaacaatatatgataagaga
caggaagattataaagtaattgagaatttgcctggccgttctttccaaaatttggaaata
gccttgtccctcggagcagctccgccagtcataaatttctacgaacgtttaaagtacaca
caagatgctcttaagcaaacggtgattctactggagttcaagagagccagtccttctaaa
ggcgatattaatgtgagtgcgcatgctggctctcaagcattgacgtatgctataaatggt
tgctcaacaatttcggtattaaccgaacctaattggttcaaaggatctttagaagactta
tctttgattcgacaaattatagatggaccaaaaacaaaaaccatagagaattacaagaga
cctgcagttttgagaaaagagtttattttcagcaagtaccagatcttagaggctcgatta
gccggtgccgatactgtactactcattgtaaaaatgctcaacaatcaagagttgttacaa
gaattatacagttactcattagagttggacatgataccactagtggaagtcaacgatggt
ccagaattggagcaagctttgaaattgacgtacaaagggtcaacgaacgagccgttgatt
ataggtgtcaacaatcgtaatttgacgaattttgatgtcgatctcggcactacaagtctg
ttggtcgagcatgccaagggaagtcagaatggccgaggtggtgatgtcttgattcttgcg
ttgtcaggaataacttcggtcgacgacgtcaagaaatataaatatgaagataatgttgat
ggttttttaattggtgagagtctcatgagagcggaatcaaaaggacaagcaggtgagttt
cttcaccaattgtgcaattgttag

DBGET integrated database retrieval system