KEGG   Lodderomyces elongisporus: LELG_00490Help
Entry
LELG_00490        CDS       T01116                                 

Definition
glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
lel  Lodderomyces elongisporus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LELG_00490
Enzymes [BR:lel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     LELG_00490
Glycosyltransferases [BR:lel01003]
 Polysaccharide
  Storage polysaccharide
   LELG_00490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 703 aa AA seqDB search
MTRDITNHLLFEVATEVAHKVGGIYSVLKSKAPITVAEYRERYTLLGPLNYHSAQIEVEE
LPVKDPLIKQTLDSMSSKGIRWLYGRWLIEGAPRVLLFDIWSAGGFLNEWKADLWNVAGI
PTPDHDSETNEAILLGYIVAWFLGELVYNDRDRAVIAHFHEWLAGVALPLCRKRRIDVTT
IFTTHATLLGRYLCAGSTDFYNNLANFDVDAEAGKRGIYHRYCIERSATHSADVFTTVSH
ITAFESEHLLKRKPDGVLPNGLNVVKFQAVHEFQNLHAVKKAKINEFIKGHFYGNYDFDL
ENTLYFFIAGRYEFRNKGCDFFIESLARLNHRLKESGSKMTVVAFIIMPGKTQSYTVETL
KGQAVIKQLESTIEEVQKKVGDRLFEHCARYPNIEHVSGDKSNEVPSIDELIKPADRVLL
KRRIYALKRDGLPPIVTHNMIDDSTDPILNQIRRVQLFNRPEDRVKIIFHPEFLNANNPI
LSLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCYMEDLIENTSDY
GIYIVDRRMKSVDESIDQLTDYMFDFCEKTRRQRINQRNRTERLSDLLDWKRMGLEYIKA
RQLSLKRAYPDKFKNGANPFNNSSNLKLTRPLSVPGSPRSKIGLMTPGDLGSLQEAQEGL
NTDDYVGFKLGLGAGDDDNNDEEERHYPLTLRGNSMPPEDDSV
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgactagagacattactaaccacttgctctttgaagtggctacggaggttgcccacaaa
gttggtggtatctactcggtgctaaaatcaaaagcaccaatcaccgtggcagaatacaga
gaacgctacactctacttgggcccttaaactaccactccgcacagattgaagttgaggag
ttgcctgttaaggacccattgatcaagcagacattggactccatgtccagcaagggtatt
cgatggctctacggtagatggttgattgaaggagctccacgggttcttttgtttgacatt
tggtctgccggtgggttcttgaatgaatggaaagcagacctttggaacgttgccggtatt
ccaaccccagaccacgactctgaaaccaatgaagccatcttgctaggatacattgtcgct
tggttcttgggagagttggtctacaatgatagagacagagcagtaattgcccatttccac
gaatggttggccggtgtcgctttgccattgtgccgcaaaagaagaatcgacgtgacaacc
atcttcaccacccacgccaccttgttgggaagatatctttgcgcaggctcaacagacttt
tataacaacttggcaaactttgatgtagatgctgaagctggaaaaagaggtatctaccac
cgttattgcattgagaggtcagctacccactctgctgacgtgtttaccactgtgtcgcac
attaccgctttcgaaagtgaacatttgttgaagagaaaaccagacggcgtgttgccaaat
ggattgaatgtggtgaaattccaagcagtacacgagtttcaaaacttgcacgcggttaaa
aaggccaagatcaatgagtttatcaagggtcatttctatggaaactacgattttgatttg
gaaaacacattgtactttttcattgctggtagatatgaatttagaaacaaaggctgtgac
tttttcattgaatccttggcaaggttgaaccacagattgaaagaaagcggttccaaaatg
acggttgtcgcattcattattatgccgggaaagactcaatcatatacagttgagactttg
aaaggtcaagctgttattaagcaattggaatctaccattgaagaagtgcaaaagaaagtt
ggtgatcgtctttttgaacactgtgctagatacccaaacattgaacacgtttctggtgac
aagtcaaacgaagtaccgtccattgacgaattaatcaagccagctgatcgtgttttgttg
aagagaagaatctatgccttgaagagagacggcttgccaccaattgtgacacacaatatg
attgacgatagcaccgaccccattttgaaccagattagacgtgttcaattgttcaatcgt
cctgaggatagagtcaagattattttccacccagagtttctcaatgcaaacaatccaatc
ttgtcattggactatgacgaatttgttcgtggttgtcatttgggtgtgtttccgtcatac
tatgagccatggggttacactccagccgagtgtaccgttatgggtattccatccattaca
acaaacttgtcgggattcggttgttatatggaagacttgattgaaaacactagtgactat
ggtatctacattgttgatcgtagaatgaagtctgtagacgagtccattgaccaattgact
gattacatgtttgatttctgtgaaaagacaagaagacaaagaatcaaccaaagaaacaga
accgagagattgagtgacttgttggactggaagagaatgggcttggagtacatcaaggca
agacaattgagtttgaagagagcataccctgacaagttcaagaatggggctaacccattc
aataactcatcgaatttgaagttgacaagaccgttatctgttccaggttcaccaagatct
aaaattggattgatgactcctggagatttgggtagtttacaagaagcacaggaaggtttg
aacacggatgactatgttggattcaaattgggattgggtgccggtgatgatgacaataac
gatgaggaagaacgccattatccattgaccttgagaggcaattccatgccgccagaggat
gactctgtataa

DBGET integrated database retrieval system