KEGG   Lodderomyces elongisporus: LELG_00496Help
Entry
LELG_00496        CDS       T01116                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
lel  Lodderomyces elongisporus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LELG_00496
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LELG_00496
   00630 Glyoxylate and dicarboxylate metabolism
    LELG_00496
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     LELG_00496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 551 aa AA seqDB search
MSSPFPKVADKVKGVQVLGPIPDSAKHIFTPEALAFVATLHRGFGKRRLELLENRAKEQV
LRDQGKLPNFLPETEHIRNDPTWTGPPLAPGLIDRRCEITGPTDRKMVINALNSNTATYM
ADFEDSLTPAWKNLVDGQVNLYDGVRRNLTYETNGKKYALNLEKGRHIPTLIVRPRGWHL
TEKHVLVDGEAVSGGIFDFAIYFFNNAYETLNRGFGPYFYLPKMEHHLEAKLWNDIFNYS
QDYIGMKRGTIRASVLIETIPAVFQMDEIIYQLREHSAGLNCGRWDYIFSYIKCLRNHPE
FILPDRSQVTMAAPFMSSYVKLLVHTTHKRQVHALGGMAAQIPIKDDEAKNKQVLENVTK
DKLREVTLGCDSCWVAHPALVPVVLKVFNEHMKGPNQIDLPPKEPFKPITQRDLLSPFVP
GGVITENGIRANIIIGISYIEAWLRNIGCVPINYLMEDAATAEVSRTQIWQWVTHGAKTN
TGKLITKDYVKQLLDEEYAKLTKSAKPGNKFKQAFAYFAPEALGEKYSDFVTTLIYDDIT
TIGRAIPGEKL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccccattcccaaaagttgcagataaagtcaagggcgtccaagtccttggccca
atcccagatagcgccaaacacattttcacaccagaggcattggcctttgttgccacatta
caccgtggctttggcaagagaagactcgagttgttggaaaacagagccaaagagcaagtc
cttagagaccaaggtaaattgccaaactttcttccagagactgaacacattagaaacgat
cctacttggactggccctccattggctccaggtttgattgacagaagatgtgaaatcacc
ggtccaaccgacagaaagatggttatcaatgctttgaactcaaacactgccacctatatg
gctgatttcgaggactctttaaccccagcttggaaaaacttggttgatggtcaagttaac
ttgtacgatggtgtaagaagaaacttgacgtatgaaaccaatggtaagaaatatgcattg
aatttggaaaaaggcagacacattccaactttgattgttagaccaagaggctggcacttg
actgagaaacacgttttggttgatggtgaagctgtttctggtggtatttttgactttgcc
atttactttttcaacaatgcttacgagactttgaacagaggctttggtccttacttttac
ttgccaaaaatggagcaccacttggaagccaagttgtggaatgacattttcaactactct
caagactacattggaatgaagagaggtacaatcagagcttcagtgttgattgagaccatc
cctgcagtgtttcaaatggatgagatcatttaccaattgagagaacattcagctggtttg
aattgtggtagatgggattacatcttttcatacatcaagtgtcttagaaaccacccagag
tttatccttccagacagatcgcaagtcaccatggcagctccattcatgtcctcttatgtt
aagctcttggtgcacaccacacacaagagacaagttcacgctttgggtggtatggctgct
caaatcccaattaaggatgacgaggcaaaaaacaagcaagttttggagaatgttaccaag
gataaattgagagaggttaccttgggctgtgactcttgttgggttgcacacccggcatta
gtgccagttgtcctcaaggtgtttaacgaacacatgaagggaccaaaccaaattgacttg
cctccaaaggagccattcaagccaatcactcaaagagacttgttgagcccatttgttcca
ggtggtgttattaccgaaaacggtatcagagccaatatcatcattggtatttcgtacatt
gaggcatggttgagaaacattggttgtgttccaatcaactacttgatggaagatgccgct
actgctgaagtgtcaagaacacaaatctggcaatgggtgacccacggtgcaaagaccaac
accggtaagttgatcaccaaagactatgtgaaacaattgttggacgaagaatacgccaag
ttgacaaagagtgccaagccaggtaacaagtttaaacaagcctttgcttactttgcacca
gaggcactcggagagaaatactctgactttgtcactactttgatctacgatgacatcacc
accattggcagagctatcccaggtgagaagttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system