KEGG   Lodderomyces elongisporus: LELG_00510Help
Entry
LELG_00510        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LELG_00510
Peptidases [BR:lel01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   LELG_00510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 241 aa AA seqDB search
MSDSKLVIPLESNPQIFSDLAHKLGLSPLLQFHDVYSLTDPDLIAFLPQPISGIILLFPL
TPGYESYRKETDQQKRVYDNSNPNINWLKQTIGNGCGLYALLHILTNLPSDLNISNLIIS
DITANLGPNKSVQETSLLIEDLERRIQLDENYGSQGQTEAPEAGANVEFHFISFIKGKDN
HLYELDGRRNGPIDLGTASDVTNENLIQEQKIVDKIQFYIDNTDEANKNNFAIMAIGPAL
D
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactccaagctggtgattccactcgagtctaatccacagatcttttctgatctc
gcacacaagttgggactctcgccactcttgcagttccatgatgtctactcgttaacggac
cctgatcttattgcatttttaccacaaccaatatctgggattattttgttatttccttta
actccagggtacgagtcatataggaaggaaactgatcaacaaaaaagagtttacgacaat
agcaaccccaacatcaactggttaaagcaaaccattggcaatggatgtggcttatatgcg
cttttgcatattctcacgaacctcccatctgacttgaacatttccaatctgataataagc
gacattactgcaaatttgggtccaaataaatccgttcaagagaccagtcttttgattgaa
gatttggaacgcagaattcaattggatgagaattacggatcacagggacaaaccgaggca
cccgaggcgggagcaaatgttgaattccatttcatttcattcataaagggcaaagacaat
cacttgtatgaactagatggaaggcgaaacggtcctatagatctcggaactgcaagtgat
gtgacgaatgaaaacttgattcaagagcaaaaaattgtagataagattcaattttacatt
gacaatacagacgaggctaataaaaacaattttgcaatcatggccattggaccagccttg
gattag

DBGET integrated database retrieval system