KEGG   Lodderomyces elongisporus: LELG_00519Help
Entry
LELG_00519        CDS       T01116                                 

Definition
profilin
Orthology
K05759  
profilin
Organism
lel  Lodderomyces elongisporus
Brite
Exosome [BR:lel04147]
 Exosomal proteins
  Proteins found in most exosomes
   LELG_00519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQAYTDNLTATGKLDKAALYSRAGDSLWAQTGSFQLQPNEITEIANGFDNASNLQSHG
LHAQGQKYFLLRNDDRSIYGKHEAEGLICVRTKQAILIAHYPSGVQPGEATTIVEKLADY
LIGVGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttatacagataacttgactgctactggcaaactcgataaagcagca
ttgtactcgagagcaggtgactcattatgggctcaaactggatcattccaattgcaacca
aacgagattactgagattgctaatggatttgacaatgcttccaacttacagagtcatggt
ttacatgcacaaggtcagaaatactttttgttgagaaacgatgatagatcgatttacggt
aaacacgaagccgagggtttgatttgtgttcgaaccaagcaagcgatattgattgctcat
taccctagcggagtgcaacctggtgaagctactaccattgttgagaaattggctgactac
ttgattggggtaggatactaa

DBGET integrated database retrieval system