KEGG   Lodderomyces elongisporus: LELG_00555Help
Entry
LELG_00555        CDS       T01116                                 

Definition
cAMP-dependent protein kinase type 3
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lel  Lodderomyces elongisporus
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:lel00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    LELG_00555
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LELG_00555
Protein kinases [BR:lel01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   LELG_00555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 442 aa AA seqDB search
MEGIQDHDIASMNESSSSRAAGRPYDQIYNSGKPNLLGNGVQSDTVPDNNNNNNNNNNNN
NNNNNISSSNITTTTTANNSSHSNETSTADVTMQGNIPKESPNSTNLSKKVSRHAYRDTT
TKGKYSLNDFQILRTLGTGSFGRVHLTRSIHNGRFYAMKVLKKERVVNMKQVEHTNDERR
MLKLAQHPFIIRMWGTFHDCHNLFMIMDYIEGGELFSLLRKSQRFPTPVAKFYAAEAFLA
IEYLHDLDIIYRDLKPENILLDKNGHIKLTDFGFAKEVADVTYTLCGTPDYIAPEVVATK
PYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKTYENILNGTITYPDYLPPDILDLLQKLI
VKDLTQRLGNLQGGSSDVKNHPWFKEVIWERLLSRDIETPYEPPITSGVGDTSQFDRYPE
DKDLDYGISGVEDPYQHFFEDF
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggaagggatacaagaccacgacatagcttcaatgaacgaatcaagctctagtcgagct
gcaggacggccgtacgaccaaatctataactcgggaaagccaaacctactgggaaacgga
gttcaaagtgacactgtgcccgacaacaacaacaacaacaacaacaacaacaacaataat
aataataataataatatcagtagcagtaatattaccaccaccactaccgcaaacaacagt
agtcacagtaacgagacttccaccgctgatgtgacgatgcagggaaatataccaaaagaa
tcaccaaactcaacgaatttgagtaaaaaagtatctagacatgcatatcgagataccaca
acaaagggcaagtatagtttgaacgattttcaaattctaagaacgttgggaactggatct
tttgggcgggtgcatttgacgaggtccatacacaatgggcgattctatgccatgaaagtg
ttgaagaaagaaagggttgtgaatatgaaacaagttgagcatacgaatgatgagcgaagg
atgctcaagcttgcgcagcatccattcatcattcgaatgtggggtaccttccatgattgc
cacaacttatttatgattatggattatattgaagggggtgagttattttcgttattgcga
aagtcgcaacggttccctacgccggtggccaaattctatgctgccgaggcctttttggcg
attgagtatttgcacgatttagacattatttaccgtgatttgaaacccgaaaacattttg
cttgataaaaatggacacataaagttgaccgattttggttttgccaaggaagtcgcagat
gtgacgtacacgctatgtggtactccagactatattgcgcctgaagttgtagcgacaaag
ccttacaacaaatcagtggactggtggtcgtttggaatattaatctttgagatgcttact
gggtacacgccattctacgacccaacacctatgaagacgtatgagaatatattgaatgga
acgataacatatcccgactatttgccacctgatattttagatcttttgcagaaattgatt
gtgaaggatttgactcagcgattaggtaatttgcaaggaggatccagtgatgtgaagaac
catccatggtttaaagaagtgatttgggagagactactatcaagggatatcgagacacca
tacgagccgccgattacctcgggagtgggtgatacttcgcaatttgatcgataccccgag
gacaaggatttggattatggaataagcggagtcgaggacccataccaacatttctttgag
gacttttaa

DBGET integrated database retrieval system