KEGG   Lodderomyces elongisporus: LELG_00560Help
Entry
LELG_00560        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
lel  Lodderomyces elongisporus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1442 aa AA seqDB search
MLNNMNLEPDNWKDKDCSDKLTSAPLQSSPTTTTTTAAAVTLNSASTSSSSSSSSSTVDS
LKPLNADMPPIQGIEQNSNDSNVNNVNNVDNVITQSMQTLAHSTGLEFNNRIDTLARDNA
TDAMNHRDGEDELREKRDVVRKHLHNFEWKIGDECYIVEDEYLSRFFNLETSSFIDLKNA
LGPVNSQRLVDSSGQLYSEQDELIKTVPIPQTVFDCLSAWFGIVGQPVVRSMIFNPETGK
LEVERWPIVFFLHILGKKPQQLHFRSGNPRHLGQSDDQPIVVSFSRTQTFTQLARFLIRY
VAKTSIDVTDDVRLWFFTDSREEEFTHHITVAKFVTEVENKRLVLPGIYDKTLESEGVVK
PLYHILLEVRDKKPGAGFPVDTFVKQNLELPNETSRDGVGRMGFSNLGNTCYMNSALQCL
LHVPEVNKYFHYGVYRKELNVDNPLGYHGNIANSFGTLLKSAFDPLKHTSSILPRDFKLT
IGRYSSVFSGYLQQDSQEFLSWLLDALHEDLNRIKAKPYCEKPELNDDEISDWNAIVRLA
DTCWKQHLQRNDSVITDLFTGLYQSTLVCPDCNKTSITFDPFNDLTLPLPISKKWYHTFT
IVDLSSLRLLPTRVMRLEVELQKTSNYDALVAYLAKYLKVPLSFLFIYELFQNSIYADFQ
ADYNKNKFMPIGDIIRDADDILVYIIPHDVENDIILPVYNAVEDEDKLYQMVHYFGLPLF
VTLDKSNLASFGTIKRKLLEVNSALTSIDLVDEYENHRQRQDNFVAKSLYQKLDFANKSV
AEDEMINSGEETDDDRSRSEVNGESKGESENGYDSDVSMADPYVRADFGFDVLYTKEQNY
RLSSYLRNRGGMGHESRMKLSSIVVNVPLHKPNIKDFKKLVNTLPELKRKFYLHEVNEAR
GIDPREKSPVLLSETQLQTHSQTQTQTQMPVQTDTQTQLLEQELEQNSFPQVNPNETTQD
DYVVVERSATGDEENTEQGVTNQTSFNRPLLPERVQQMSQINLSDEDTESEVNLGSLFGS
SSNLPLPNSSSYFDSTKPSNINSPIEMNANEIEVNDYSNGNLVDEYTILVCKWDAEVYQK
CFTNENPIISSNLSSLPQLPNKELEQNKAKFERQRKSRISLAECLKYFSTPELLGEHDLW
YCPRCKAHKRATKTIQLWSAGDILTIHLKRFHSARAFSDKIDVVIDFPILGLDISDFVSN
PTIKKEDCVYDLIAVDNHYGGLGGGHYTASVKNFCDDKWYYFNDSRVTEISDPEEVITSA
AYLLFYRKRAPNADLGGDKLSSIISNEAEAFNSMKVRKEAAIKDVEGQIELFASGLKLGA
DDYEEKYEDNENEEKKSCNSDNKASSNASSTSDSDRNQDRNDYEEEEEEDDDENDEDDDD
DDDDDATPNLRKQRINSKDYGSLLQMKRQKTKNLSTLSKLEDDSPVSVEFAGDTRDADKK
AV
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacaatatgaatttagaaccagacaattggaaagacaaggattgcagtgataaa
cttacatctgcaccattacaatcatcaccaacaacaacaacaacaacagcagcagcagta
acactaaattcagcttcaacatcatcatcatcatcatcatcatcctccactgtggattca
cttaaacctttaaatgcagatatgccacctatacagggaattgaacaaaacagtaacgac
agcaacgttaacaacgtgaacaacgttgacaacgtaattacacaaagtatgcaaacactg
gcacattctacaggacttgaatttaataatcgcattgatactcttgcaagagataatgca
acggatgctatgaaccaccgagatggtgaggatgaattgcgtgagaaaagagatgttgtt
agaaaacatttgcataattttgagtggaaaatcggagatgagtgctatattgtggaggat
gaatatttgtcacgttttttcaatttggaaacttcttcttttatcgacttgaagaatgca
cttggtcctgtcaattctcaaagattagttgatagttcaggacagttatactctgaacaa
gacgaattaataaagactgtacccatcccacaaacagtatttgattgtttatcagcatgg
tttggtatcgtggggcaaccagtggttagatcaatgatttttaaccctgaaacgggaaaa
ttggaggtggaacgatggcccattgtgtttttcttgcacattcttggcaagaaacctcag
caactgcactttcgaagtggcaaccctcgccatcttggccaatccgatgatcagcccatt
gtggtttcattttctagaactcaaacatttacacaattggcaagattcttaatccgatac
gttgcaaagacaagtatagatgttactgacgatgtgaggctctggttctttacagattca
agggaggaagaatttacacatcacataacggttgcaaaatttgttactgaggttgaaaac
aaaaggttagtattgccggggatatatgacaagactttggaatctgaaggagtagtcaag
ccattgtaccatattcttttggaagttagagacaagaaaccaggcgctggattcccagtt
gatacctttgtcaagcaaaatttagaactgccaaatgaaacttctcgagatggagtggga
cgcatggggttttccaacttgggaaacacgtgctatatgaactcggctttgcaatgtctc
cttcatgttcctgaagtcaataaatattttcattatggagtatatcgaaaagaacttaat
gttgacaatccacttggatatcacggaaacatagccaactccttcggaaccttgttgaaa
tctgcatttgacccattaaagcacacctcaagtatactgccaagggatttcaagctgact
attggcagatatagttctgtgttttccggatacctccaacaagattctcaagagtttctc
agttggcttttagatgctcttcacgaagatttgaatcgtatcaaggccaagccatattgt
gagaagcctgagctcaacgatgatgagattagtgactggaatgcaatagtgaggcttgct
gacacatgctggaagcagcacttgcagaggaatgactcggtaataaccgatctatttact
ggtttgtatcagtcgacgcttgtgtgtcccgattgtaacaagacttcaattacatttgat
ccattcaatgacttgaccttgccattgcctataagcaagaaatggtaccacacttttacc
attgttgatttgtcgtcactgagactacttcctacaagggtgatgcggttggaggtagag
ttgcaaaagacatcaaattatgatgcattggttgcatatttggcaaagtacttgaaagtg
cctctgtcttttttgtttatatatgagcttttccaaaattccatatacgctgattttcaa
gcagactacaacaagaataagtttatgccgattggtgatataatcagagatgcagacgac
attttggtgtatattattcctcatgatgttgaaaatgatattatattaccagtttataat
gcagttgaggatgaggacaaactgtaccagatggtgcactactttgggcttccgttgttt
gtcacattggacaagtcaaatcttgcaagttttggcacgatcaaaagaaagcttttagaa
gtcaattctgccttaacctctatcgatctcgttgacgagtatgaaaaccacaggcaaaga
caagataattttgttgcgaaaagtttataccaaaagctggattttgcaaacaagagtgtg
gcagaagatgaaatgatcaatagcggcgaggaaactgatgacgatagaagcaggagtgaa
gttaatggtgagagtaagggtgagagtgagaatgggtatgacagtgatgtatcaatggca
gacccatatgttagagccgattttgggtttgatgtgttgtatacaaaagaacaaaactat
cgactgagctcatatttgcgtaatagaggtggaatgggacatgagagccgcatgaagctg
tcaagtattgttgttaatgtaccacttcataagccaaatattaaagatttcaaaaagttg
gtaaatacattacctgagttgaagcggaaattttaccttcacgaggttaatgaagctcgt
ggtatcgatccacgagaaaaaagccctgtgctgctgtcagagactcaattgcagacgcat
tcgcaaacacaaacacaaacgcaaatgccagtacagactgatactcagacccaattgttg
gagcaagagctggagcaaaatagttttccacaagtcaatcctaatgagacaacacaggat
gattacgtcgtggttgagagaagtgcaacaggcgatgaggagaataccgagcaaggagtc
accaaccaaacatcttttaatcgtcctcttctacctgagcgggtgcagcaaatgtctcaa
ataaatctgtctgacgaagataccgaaagcgaagtgaatctaggcagcttatttggctca
agctcaaatcttccactcccaaactcttcatcttactttgactcgaccaagccttccaac
atcaattcgccaatagagatgaatgcaaatgaaattgaggttaacgattattcaaatgga
aatttagttgatgagtatactatcttggtatgcaaatgggatgctgaggtttatcaaaaa
tgctttaccaatgagaaccccataatctcgtctaatttgtcttcattgccacaattgccc
aacaaggagttggaacaaaacaaggcaaagttcgaacgtcagaggaaaagtagaatatca
ttggcggagtgtctaaagtactttagcaccccggagcttttgggtgaacatgatttgtgg
tattgtccaagatgcaaggctcataagcgtgccacaaaaacaatccagctatggtctgcg
ggagatatcctcactattcatttaaagagatttcatagtgctcgtgcatttagcgacaag
attgatgttgttattgattttccgatactgggcttggatattagcgattttgtttcaaat
ccaacaattaaaaaggaagactgtgtatatgatttgatagctgttgacaatcattatggt
ggccttggaggtggtcattacactgcttcggtaaagaacttttgtgatgacaaatggtac
tatttcaatgatagtcgtgttacggagattagtgaccctgaagaggtgattacgagtgcc
gcatacttgttgttctaccggaagagggcacctaatgcagatttgggaggtgataaatta
tccagcattatctctaacgaggcggaagcgtttaatagtatgaaggtaagaaaggaagca
gctataaaggatgttgagggtcaaattgaactttttgcatctggattgaaattgggagca
gatgattatgaagaaaaatacgaggataatgaaaatgaagagaagaaaagttgtaattcc
gataataaagcatcttctaatgcatcgtctacaagcgatagtgatcgaaatcaagacaga
aatgactatgaagaggaagaagaggaagatgatgatgaaaatgatgaagatgatgatgat
gatgatgatgatgatgcgacgcctaatttgaggaagcaacgcattaacagtaaggattat
ggtagtcttctgcagatgaagagacagaaaacgaaaaatttgagcacgctgtctaaactt
gaggatgatagtcctgtttctgttgaatttgctggtgacactcgtgatgctgataagaaa
gccgtataa

DBGET integrated database retrieval system