KEGG   Lodderomyces elongisporus: LELG_00592Help
Entry
LELG_00592        CDS       T01116                                 

Definition
acyl-CoA desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lel01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lel01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 492 aa AA seqDB search
MTTETTNTRVDELEVAEVTKLNAIAAGTNKKVPRIVASGWGGKLMGTADLVKVTAEEITK
DSMESLAEKDAREKAKYANKKHISEEPWTRENFMAKINWLNVILTVAVPVFGIIQAILSP
PQWKTLALGFVLYVFSGISITAGYHRLYSHKSYDAALPVRMFFAFFGAGAIEGSIKWWGH
SHRVHHRYTDTPRDPYDARRGFWYSHMGWMLMKANPKNRARADISDLTADWVVRFQHRHY
LMIMLVAAFVTPTLVAGLGWGDYWGGFIYAGIFKSFFIQQATFCVNSLAHWIGVQPFDDR
RTPRDHVLTAFVTFGEGYHNFHHEFPSDYRNALKWYQYDPTKVIIYALSKLGLAWNLKMF
SQNAIEQGLLQQQQKKLDRMRQKLKWGSSVEDLPVWTREEFHARAKDEGLIIISGIIHNV
KLFIKEHPGGQALVRASLGKDATSAFSGAVYAHSNAAHNLLATMRVAVVKDIAHDGDTFH
VQEVIMEKEKQS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagagacaacaaatacacgtgttgacgaattggaggttgccgaagtcaccaag
ctcaatgccattgctgcaggaaccaacaagaaggttcccagaattgtagcctcaggatgg
ggtggtaagctcatgggtactgccgacttggtcaaagtgacggccgaggaaatcacaaag
gattcaatggaatccttggctgaaaaagatgctagagaaaaggccaagtatgccaacaaa
aaacacatttcagaagaaccatggacgagggaaaactttatggccaagattaactggctc
aatgtcattttgacagtggctgtcccagtctttggtattatccaggccattctctcgcca
ccacaatggaaaacactcgcattgggctttgtcctctatgtttttagcggtatctccatt
actgctgggtaccaccgtctttattcacacaagtcttatgacgcagcattaccagtgaga
atgtttttcgcctttttcggcgctggtgccattgaaggttccatcaaatggtggggccac
tcccaccgtgtccaccacagatataccgataccccaagagacccatacgatgcaagaaga
ggattttggtacagtcacatgggatggatgttgatgaaggcaaacccaaagaatagagca
agagcagacatttcagacttgactgccgactgggtggttagattccaacacagacactat
ttgatgattatgctcgttgccgcttttgttacaccaaccttggttgccggtttaggatgg
ggcgactactggggcggatttatttatgctggtatctttaaatcctttttcatccaacaa
gctaccttttgcgtcaattcgttggcccactggatcggcgtacaaccatttgacgataga
agaactccaagagaccatgtattgactgcatttgttacctttggagaaggttaccacaat
ttccaccacgaatttccaagtgattatagaaatgcattgaagtggtaccaatacgaccca
acaaaggttatcatttatgccttgtccaaattgggccttgcatggaacttgaagatgttt
tcacaaaatgctattgaacaaggtttgttgcaacaacagcaaaagaagttggacagaatg
agacaaaagctcaagtggggatcaagtgtcgaggacttgccagtatggacgagagaggag
ttccacgcaagagccaaggacgaaggattgattatcatctcgggaattatccacaatgtc
aagctgtttatcaaggaacacccaggtggacaagccttggttagagcctcactcggaaag
gatgccacttctgcatttagcggtgcagtttacgcacactccaatgcagcacacaattta
ttggctacaatgagagtcgcagtggtgaaagacattgcccatgacggtgacaccttccat
gtacaagaggtgattatggaaaaggaaaaacaaagctag

DBGET integrated database retrieval system