KEGG   Lodderomyces elongisporus: LELG_00684Help
Entry
LELG_00684        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     LELG_00684
Protein kinases [BR:lel01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   LELG_00684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 806 aa AA seqDB search
MVLVEEKLSQISINKSSPHKCTESPSQHQQYRHQHYQHQQLQGFDKSMSYNERPNYISQT
PHRAPIKEFKSQSTIPSHTSFTNSPQCAMSEQQNPKKIYQFSFMKETSSSIQRRQNSTRS
PFVSNSYASQLMRPSAASSSSSSSITTTAAGVAAGAPAGASAGALAPPPPPTTTTPSIGT
SSAAKKRLEYSRHLSHTVRTRRHPFANSSSNSNSHTLKKPSDITNIRDFNGDFGGVTASA
VAQRTTPEVARVTRSPNIPDKIGSPEASGTTNKLLPCFRDNYHNDDKMDISPIKFKTTGQ
FNSKPFIQNQPQNVFQRLYSPRKPIREVEIRGAESPPRIQTPRRVTSRPKIESYIQLNQI
LYQRDPDLFTDYTISVSPEVEPGLLKAPLQAKDISLNNLNIYERGEVLRKEKVYYVPQAS
LREINLTSYEDNFGFDDSNGNYKVIPNDHIGYRYQVLRNIGNGSFGNVVLARDHKFVGNS
LVAVKIINNNLSSSMQSVNEIKMLKLIRDNGGHPNVINFYNQFNFRSHVCIATELLSLNL
YSLLEITKFQGLSVSLIEPFARQILQGLRFLHNLKIIHCDIKPENVMLKLPSDPLSSNIT
VKLIDFGSSCFYNEKTFTYIQSRFYRAPEIIIGADYDSKIDIWSVGCVLAELFTGAPLFP
GKNEIDQVGLILEILGAPKSSTILKLRSQQSKSLQVFSTKNIESINKFPSTSQLKKTLLY
RIFDINGKINMNILNHYKASTTDPYSAKKQFRLNSKSLEMSLGISTASSNHSIKRKQFLE
FLQKMFVWDPTERASVDDLLNEIFIH
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggtgttggtggaagagaagctatctcagattagcatcaacaagtcctctccgcacaaa
tgcactgagagtccttcgcagcatcagcagtatcgtcatcagcattatcagcatcagcag
ctgcaaggatttgacaaatccatgtcctataatgaacgaccgaactatatatcgcaaacg
ccacacagggcacctatcaaggaatttaaatcacagagtaccatcccttctcacacatct
ttcactaactcaccacaatgtgccatgtcggaacaacaaaatccaaagaaaatctatcag
ttttcattcatgaaggaaacttcttcatccatacaaaggagacaaaactcaacaagaagc
ccattcgtatccaattcttatgcatcacaacttatgagaccatcagcggcatcatcatca
tcatcatcatcaataacaacaacagcagcaggagtagcagcaggagcaccagcaggagca
tcagcaggagcactagcaccaccaccaccaccaacaacaacaactccatccataggtacc
tcttcagcagctaaaaagagactcgagtattcacggcatttgtcacatactgtgcggaca
aggcggcatccctttgcaaacagtagcagcaacagcaacagtcatactttaaagaagcct
agcgacatcactaatatccgtgattttaatggggactttggaggagttacagcctcagca
gtagcgcaaagaacaacaccggaagtagcaagggtaacaagatcgccgaatataccagat
aaaataggatcacctgaagcatctggaacaacaaacaaactactgccgtgtttcagagat
aattatcataacgacgacaaaatggatatttcccctataaagttcaaaactacaggccaa
tttaatagtaaaccctttatacaaaatcagccacagaatgtatttcaacggctttattct
ccaagaaaaccaatacgagaagtagagatccgaggagctgagagcccaccacgtattcaa
acaccacgaagagtcacgagcaggcccaaaattgaaagttatattcaactaaatcaaata
ttataccagcgagaccccgacttgtttacagattacaccatttcagtgagccccgaagta
gagccagggctgttaaaagcgcctttgcaggcaaaggatatatcgctcaacaatctcaat
atatacgaaagaggtgaagtcttgaggaaagaaaaggtttattatgtaccacaagcatca
ctgcgagaaataaatttaacgagctatgaagataatttcggttttgatgatagtaatggg
aactacaaagtaattcctaatgaccacattgggtaccgataccaagttttacgaaacatt
ggtaatggttcatttggtaacgttgttttggcgagggatcataaatttgtcggtaatagt
cttgtagcggtcaagattatcaataacaacttgagctcatcaatgcagtctgtaaacgag
atcaagatgttgaaattgataagagataatggtggtcaccctaatgtgattaacttttat
aatcagttcaatttcaggagccatgtttgcattgcaacagaattactttcacttaactta
tactccttactcgaaataacaaaattccaaggactctctgtaagtttgattgagccattt
gcacgccaaatattgcaaggtctaagattccttcataacctaaaaatcatccactgcgat
ataaagccagagaatgtgatgctaaaacttccaagtgacccattgtcttcgaatataacc
gttaagctaattgattttgggtcatcatgcttttacaatgaaaaaacttttacatatatt
caatctaggttttatagagcaccagagattatcattggagccgattacgatagcaaaatt
gatatatggtctgttggatgtgtccttgctgagttatttaccggagcgccattgttccct
ggtaaaaatgaaattgaccaagttggcttaatattggaaattttgggtgctccaaagtcc
tccacaatattaaagttgcggtctcagcaatccaaatctttgcaagttttttcgacaaag
aacatagagtcgataaataaatttccaagcaccagtcagttgaaaaagacattgttgtac
agaatatttgacataaatggcaaaatcaacatgaacattttgaaccactataaggcgtcc
actaccgatccctacagcgcgaagaaacaatttcgcctaaattcaaaaagtttggaaatg
agtttgggtattagcacagcgagttcgaaccattccataaagagaaaacagtttttggag
tttttacaaaagatgtttgtatgggaccccaccgaaagggcgagtgtcgatgatttgcta
aacgaaattttcatccattga

DBGET integrated database retrieval system