KEGG   Lodderomyces elongisporus: LELG_01013Help
Entry
LELG_01013        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
lel  Lodderomyces elongisporus
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:lel00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    LELG_01013
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     LELG_01013
Protein kinases [BR:lel01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   LELG_01013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 573 aa AA seqDB search
MSGIPLFNVPNTKRAFNSPALPSLSIPESHNNTKPPRLLLNTNNTKTNSDCYKSINNNLN
NLNNNLNNNNNDAFESHFAQALNLNQVEHRDDFTAPKNVDNQTTFPAVPPQRPQIVNVNS
TSSSSSMSSTTPVTAQSIASSSSSTKLKRKPPPRSTTDHSQQIGNEGHDGKLKAKEQRNK
EEEAEDREEEEEEEEEKDDDNDDDDDMKDEENCEKGQKGEDTAVRSKEQEVEISGNNTLE
TRPNYENIDNRARNPLPIANNIRKYMYLEDIKPYEWHYLANNNQIKKVGSLGEGNGGAVT
KCYILQMPTRPLFALKLIITDPEPQIQKQIFRELEIARKYQHQNIVKYYGTFLQEKQSMI
GITMEYMDGKSLDAIYKEVLKRDPTNRINEKVLGKIANSILNGLDYLHLKNIIHRDIKPS
NVLLDTKGAVKLCDFGVSGEAVNSLASTFVGTQYYMAPERIMGKDYSISSDIWSLGMSML
EVANGKFPIDLSLGPIEVVEMVLRSELLLKDSEIDNIHWTFEFKRFISRCLIKDSKRRPI
PREMLAHDEWCVSQLKEKVKMDKFVKVVWKLNE
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaattccactctttaatgtaccaaataccaaaagggcgttcaatagtcctgcc
cttccatccttgtccattccagaaagccacaataatacaaaaccaccgcgtttactgcta
aataccaataacaccaaaacaaatagtgactgttataaatcgataaacaacaacctcaac
aacctcaacaacaacctcaacaacaacaacaatgatgcatttgaatctcattttgctcaa
gcattgaacttgaatcaggttgaacatagagatgacttcactgcaccgaaaaatgtagac
aatcaaaccacatttcccgcagtcccaccacaaagaccacaaatagtcaatgtcaactcg
acttcttcgtcatcgtctatgtcttcaaccacaccggtaacagcacaatcaattgcgtca
tcatcaagctcaacaaagcttaaacggaaaccacctccacgctcaaccacagatcattct
caacaaattggaaatgagggccatgatggaaaactaaaagcaaaagaacaaaggaataaa
gaagaggaagcagaagatagagaagaagaagaagaagaagaagaagaaaaagatgatgac
aatgacgatgacgacgacatgaaggacgaagaaaattgtgaaaagggccaaaaaggggaa
gatacagcggtgaggagcaaagagcaagaagtggaaataagtggaaacaatacccttgaa
actaggccaaattacgaaaatattgacaatagggcacgcaatcctctgccgattgccaat
aatatacgcaaatacatgtatttggaggatattaaaccgtacgagtggcactatttggcc
aacaataaccaaataaaaaaagttgggagtttgggtgaaggaaatggaggagcagtaaca
aaatgctatatactgcaaatgcctacacgaccactctttgcgttaaaactaataatcaca
gaccctgaaccgcaaatacagaaacaaatttttagagaattagaaatcgctcgcaaatat
caacatcaaaacattgtaaagtactatggtacgtttctacaagaaaaacagagcatgatt
ggaatcaccatggaatatatggacggtaaatcattggacgcgatatacaaggaagttctc
aaacgtgatcctacaaatcgtatcaatgaaaaagtattgggcaaaatagccaactcgatc
ctcaatggtttagactatctacatctgaaaaatattattcacagagatattaaaccctca
aatgtcctcctagacaccaagggagcggtaaaactatgtgactttggcgttagtggagaa
gcagttaactcactcgcatcgacatttgtaggaacacaatactatatggcaccagaaaga
attatgggtaaagattattcgatatctagtgatatatggtcattgggcatgtcaatgctt
gaagtggcaaatggtaaattccccatagatttaagtttaggcccaatcgaagttgtggag
atggtactgagaagcgaactacttcttaaagactcggaaatagacaatatccattggaca
tttgaattcaaacgatttatatctagatgtcttattaaggacagcaaaagaagacccatt
ccaagagaaatgttggcacatgacgaatggtgcgtttctcaactgaaggaaaaagttaag
atggacaagtttgtcaaagtcgtttggaaattgaatgagtga

DBGET integrated database retrieval system