KEGG   Lodderomyces elongisporus: LELG_01118Help
Entry
LELG_01118        CDS       T01116                                 

Definition
similar to ubiquitin hydrolase
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
lel  Lodderomyces elongisporus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 814 aa AA seqDB search
MLDLPSDIPANVPLGVKIYKDQCIYNYDTPENNELGIDIDLKTYRAYSRNKDYNFTKQNY
EQTGDYLYLNIRRALKPQEEINKLLYDDNGEKSPKIQKLEIKNVKEEDYYITQLAIYDIR
DERLYTQEEVTSKLWGVAEQILERNSLNKENEIKQWEQEIVPCPHSIDLQPNNERASELD
SRTEPGKCHECELTENLWICLHCGQLGCGRQQYGSTLKGNGHALKHYEETPTHPVALKLG
SLSKESESCDAYCYQCNDEVKVPDLAAKLKVFNIDLETAKKTEKSLVELNIDQNLNWDFR
LEGANGEKLPAVYGKGLTGMQNLGNSCYLNSVLQALLDLDSYKQFILQLDFSSSKDPTED
IKAQLIKLYDGVWSGRYSIPGSLKGEDYQLGIKPSDFKTLIGKDHEEFKTQRQQDALEFL
QYFFSKTDQMLGLKLNENFKFLFDTKIVCANCNHGSIKEELLDNISVPLPAEENKNSEST
TIEKCLRSLVAKEAIADYQCDHCHHSPGMAYKSSGFSTYPRNLVIGVQRIKLKNWTPVKV
EDPISLEYELDLSTFEAPKFATGESENQLENREENTDASPSSSLKFVPNADALEMLLSMG
FPEVRCINALHATGNSDTEMAMNWILANMDDPTIDVPLDENNKNSGNTSEIPTNVDVVGD
GNGAENDASIGNLTEMGFSYQLSKKALHVSKGDLEAAVAWLFDNPDDDGIIVENDELKVD
VKKEERELIKTLQGQAHDSNNNLVNRKTRYNLKSVICHKGTSPHTGHYVVFIRKLIDGKW
TWVLFNDEKVVVCDENSLAEIEKTGYIYIYEKAE
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgttagatttaccttcagatattccagcaaatgtacctttaggagtcaagatctacaag
gaccaatgtatatacaattacgacacgccagagaataatgagttgggaattgatattgat
ctcaagacatacagggcctactcgagaaataaagattataactttacaaaacaaaattat
gaacagactggagattacttatatcttaacattaggagagctcttaaacctcaagaggag
ataaacaagttgttgtatgacgataatggtgaaaaaagtcccaaaatacaaaaacttgag
ataaagaatgttaaagaagaagactattacattacacaactcgcaatttacgatataaga
gatgaacgtttgtacacacaagaagaagttacctccaagttatggggtgtagctgagcaa
attcttgaaagaaattctttgaacaaagagaatgaaataaaacaatgggagcaagaaatt
gttccttgtccccactccattgatttacaaccaaataatgagcgtgcttcagaattggat
tcaagaactgaaccgggcaagtgtcacgagtgcgagttgacggaaaacttgtggatttgt
ctccattgtggacaattggggtgtggaaggcaacagtatggctcaacattgaaaggaaat
ggccacgctttaaaacattacgaagaaacaccaacacatcctgttgcattgaaattgggc
tcgttaagcaaggaatcggaaagctgcgatgcctactgttatcaatgtaatgacgaagtt
aaggtccctgatttagcagccaaattaaaagtattcaatattgaccttgaaacagcgaaa
aagacagaaaaatctttagtcgaattgaacattgatcaaaatcttaactgggattttaga
ttagaaggtgcaaacggtgaaaagttaccggctgtttatggtaagggattaactggaatg
caaaacttgggtaactcttgctacttaaactccgtcttgcaagctctattagacttggat
agttataagcaatttattctgcagcttgactttagctctagcaaagatcccacagaggat
atcaaagcccagcttataaagttatacgatggagtttggagtggccgatactcgattcct
ggttctttaaaaggtgaagattatcaactcggtataaagccgtcggattttaagacgttg
attggaaaagatcatgaggaattcaaaactcaacgtcaacaggatgctttggagtttcta
caatatttcttcagtaaaacggatcaaatgcttggtctcaagttaaatgaaaactttaaa
ttcttattcgacactaaaatcgtttgcgcaaattgtaatcacggttcgattaaagaagaa
cttttggataatatatctgttccgcttcctgctgaagaaaacaagaattcggaaagcact
actatcgaaaagtgtttgagaagtttagttgcaaaagaggcaattgctgattatcaatgt
gatcattgccaccacagtcctggtatggcctacaaatcgagtggatttagtacttatcca
aggaatttggtcattggtgtgcaaagaattaaactcaagaattggacacccgtaaaagtt
gaggatccaatttctctcgagtatgaattagatttgagcacttttgaggctccaaaattc
gctacaggtgaaagtgaaaaccaacttgaaaatagggaagaaaatactgatgcttcacct
tcttcttccttaaaatttgtaccaaacgcagatgcgttggaaatgcttttgtctatgggt
tttcctgaagtgagatgtattaatgcattgcatgcaacaggaaacagtgacacagagatg
gcaatgaactggattctcgcaaatatggacgatccaactattgatgtgcccctcgatgaa
aacaacaaaaatagtggtaacacaagcgaaattccaaccaacgttgatgttgttggtgat
ggtaatggtgctgaaaacgatgcatccattgggaacttaacggaaatgggcttttcttat
cagttatccaaaaaagcgttacatgttagtaagggagatctagaagcagctgttgcatgg
ttatttgataatcctgatgatgatggtatcattgtcgaaaatgacgaactcaaagtcgac
gtgaaaaaagaagaacgtgagttgataaagacgttacaaggacaagctcatgacagtaac
aacaatttagtaaaccgaaaaactcgatataacctcaagtctgtcatttgccacaaggga
acatctcctcataccggacactatgtcgtttttattagaaaattaattgatggcaaatgg
acatgggtcctcttcaatgatgaaaaagttgttgtttgtgatgagaatagcctcgctgaa
attgagaaaactggatacatctacatttatgagaaagctgagtaa

DBGET integrated database retrieval system