KEGG   Lodderomyces elongisporus: LELG_01182Help
Entry
LELG_01182        CDS       T01116                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
lel  Lodderomyces elongisporus
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LELG_01182
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    LELG_01182
Enzymes [BR:lel01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     LELG_01182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
MSVEIVKSSYGKANVKFLKVRKDANNPKVQEILEANVKVLLRGKFDTSYTEADNSSIVPT
DTVKNTILVEAKTHNVWPIESFAAHLAKHFTSKYEQVEGIEVSIVQALWKKIQLEGKEHD
HSFKHEGPETRQTYLNYEKASKKLQLSSSIKDLKVLKSTGSMFYGYNVCDYTTLKPTKDR
ILSTDVEATWTFDSNKIGTLDDIIKSGSIFDNAYNQAKDVTLELFCKENSPSVQATMYNM
SQKILDNVSEIATVRYVLPNIHYILFNFEWKGIKNNDDLFYPSSDPNGLITCTVGRKGDK
AKL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtagaaatagttaaaagctcatacggtaaagctaacgtcaagtttctcaaggtt
agaaaagatgcaaacaaccccaaagttcaagaaattcttgaagccaatgtgaaagttttg
ttgaggggtaaatttgatacttcatacactgaagcagacaattcatcaattgttccaacc
gatacagtcaaaaacaccattttggttgaggcaaagactcacaacgtttggccaattgaa
tcatttgctgctcatttagccaaacattttacttcaaagtatgagcaagtggaaggtatc
gaagttagcatagtgcaggcattatggaagaaaatacaacttgaaggtaaagaacacgat
cactcatttaagcacgaaggaccagaaactcgtcaaacgtatttgaactatgagaaggct
agcaaaaaattacagttatcttcatcaattaaggatttgaaagtcttgaaatcaaccggt
tcaatgttttatggttacaatgtatgtgactacactactttgaaaccaaccaaagacaga
atcttatctacagatgtcgaggctacatggacatttgactcaaacaagattggaactttg
gatgacattatcaagagcggttcgatctttgataacgcatataaccaagctaaggacgtc
actttggaattgttttgcaaagagaactcgccatctgtgcaagccaccatgtacaacatg
tcacaaaagattttggacaacgttagcgagattgcaacagtgagatacgtattaccaaat
atccactacatcttgttcaactttgagtggaagggaatcaaaaacaatgatgacttattc
tacccatcctctgatccaaacggtttgatcacatgtaccgtcggtagaaaaggtgataaa
gctaaattatag

DBGET integrated database retrieval system