KEGG   Lodderomyces elongisporus: LELG_01207Help
Entry
LELG_01207        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LELG_01207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 403 aa AA seqDB search
MHGMLQSSLNTTITDPILNPNIPDKNSNQPTSIPATSASASASASASASASGATSTSKTN
SKSTPFYGQSNFINIGKITLGKYKFQPWFSNTAYFYPHEGSHDQLGYEYANQVSLEPNSR
RRLKITDRECSIKNLYVCEYCFKYSQSGTAVVAHQHICPNNVPKPKVGSLAYYDYEKGIV
IREVRGYQDPLFCQNLCLFGKLFLDDKSVYYNVDHFNFYIYYAKPDAKENYKPMGFFSKE
MIAYDNSNNLACICVFPPYQRRGIGQLLIELLYMLESSPTSNSDRRTGPEVPLSPYGKAA
YLKYWSACVVQSLLEYGSVSNGGTELFSKNTDLLKVTLDQLGAANHLRKEDVLFTMEHMG
ILITENDKVYVSLKALNKWKDKKKKTHDSINYLLQPKYLSKLV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcatggcatgttgcaaagcagtctaaatacaacaattacagatccaattctgaatcca
aacataccagacaaaaacagcaatcaaccaacctcgataccagctacttctgcttctgct
tctgcttctgcttctgcttccgcttctgcttccggagccacatcaacatctaaaacaaat
tctaaatcgacacctttttatggtcagtccaatttcatcaacattggaaaaatcacatta
gggaaatacaaatttcaaccatggttcagcaacactgcatacttttatcctcatgaaggg
tcacatgaccaattgggatacgaatatgccaatcaagtttctcttgagcccaactcgcga
cgccgtctgaaaatcaccgacagagagtgctcgattaaaaacctctacgtatgtgaatat
tgttttaaatactcacagtcaggcactgctgtcgtggcgcaccaacatatatgtccaaac
aacgtgccaaaaccaaaagtcggtagcttggcatactatgattacgaaaaaggaatcgtg
ataagggaagtacgagggtaccaggacccattattctgtcaaaacctatgtcttttcgga
aaattgtttcttgacgacaaatctgtttattataatgttgaccattttaatttttatata
tactatgctaaacctgacgccaaggagaactacaaaccaatgggattcttttccaaggag
atgattgcatatgataactcgaataaccttgcatgcatttgcgtgtttccaccgtatcaa
agaaggggtattggtcagctgttgatcgagttgctgtatatgctcgaaagctcgccgacc
tcaaactctgataggagaacagggcccgaggtgccactatcgccgtatgggaaagctgca
tatctcaaatactggtccgcatgtgtggtgcaaagcttgcttgagtatggatcggtatct
aatggaggaactgagctgtttagcaaaaatacggacctcttgaaagtcacccttgaccaa
ttgggtgcagcaaatcatcttcgaaaagaagatgtcttatttacaatggaacatatgggt
atattaatcactgaaaacgataaggtctacgtatctttgaaagctttgaacaaatggaag
gataaaaaaaagaaaacacatgactcaatcaactatttacttcaaccaaagtatttgagc
aaacttgtctag

DBGET integrated database retrieval system