KEGG   Lodderomyces elongisporus: LELG_01250Help
Entry
LELG_01250        CDS       T01116                                 

Definition
similar to ubiquitin carboxyl-terminal hydrolase
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LELG_01250
Peptidases [BR:lel01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LELG_01250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 841 aa AA seqDB search
MPEALQQLPYGDGNTKIFGMENFGNTCYCNSILQCLYYTEAFRKQLLQHNLTKHEPKLIV
NGVKFHGFTQKYEQLVQKRLKEQGSATLNNGEERPKLSRKGSLFGLKFNNSASTQTAVLD
ESSKFSQRAGDCEALPLEQRILINKSPEFLNLDILITRPNAIQSNNNNNNNNNNNNRAQH
NSVGSEASDQSSSANTSFNNNTSNNTSNGATHGAGNSASNSANNMDYSQSSSMLLSEQLP
QTIQEGSINTYSSVVIVGIPKPELNLNPPINPFNINPNADQRKRSALINGPVINLDTSLQ
LPTEQHEDTILLYALKDLFESMVENKSTIGVVSPSFFISKLKEKNYLFRQNNMHHDAHEF
FNYLINEIIESLNKESKPNWCTDLFQGLITNETKCLSCETVTSRHEHFLDLSIDIPPGEN
AYSLNYAINNFSKSETLTNQNKFHCNTCSSLQEAVKTIKVKKLPNVLVINLKRFKYDEKI
DKLVKLFDSISYPFKLRLFNTTDDCFENILYELYALVIHIGGGPMHGHYVSICKIKAGLW
LLFDDETVELVEDNYVMRFFGNGPGLASAYILFYQKIEFDENAEYFGFDPATMFNGKDFE
FPMSSNNVAESSSASVNTSTVAFTSAPMAPLAAASAASAASVASATMATGPGSTATRTRT
TSTGTTGNGVELDNKIDTTPTDDSVAMKADIDKKPPLSSGGMFKSFKFEKEEKAQTLSRS
NSTGASTLLQNNQQNGKDTKSKKSWLGTLKRTGLERKLSGKSPTIVEAPKAEKESTEEAQ
PVVEHESTSAPAPKGGLVKSTSHAHAPAPIPAPIPAPIPPPSRPAQMEKRRSLFGFKKNA
S
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagcattgcaacagctcccctatggggatggaaacacaaagatttttggaatg
gagaattttggaaatacatgttactgcaattccatcttacaatgtctatactacacagag
gcgtttcgtaaacaactactccaacacaatttgactaaacatgaaccgaaactaattgtt
aatggtgtcaagtttcatgggttcacgcagaaatacgaacaattggtacaaaagagatta
aaagaacaaggaagtgcaacactgaacaatggcgaagaaagacccaagctgagtcgaaag
ggatcactatttggacttaaattcaataatagtgcaagtacgcaaactgctgttcttgac
gaaagcagcaaattttcgcaacgagcaggcgattgcgaggcattgccacttgaacaaagg
atattgatcaataagagcccagagtttctgaatttagatattttgatcacgcgtcccaat
gctatacagagcaataataataataataataataataataataataacagagctcagcac
aattccgtaggtagtgaagccagtgatcaatcatcctcagcaaatacatcgtttaacaac
aacacgagcaataacacgagcaatggtgcgacacatggtgctggcaacagtgcaagcaac
agcgcaaacaatatggactattcacaaagttcatccatgcttttaagtgaacaactgccg
caaacaatccaagaaggatccataaacacatattctagtgttgttattgttggaatacca
aaacctgaattgaacttgaatccacctataaatccattcaatattaacccaaatgctgat
cagcgaaaacgctctgcattgatcaatggccctgtaattaatttggatacatcattgcag
cttcccactgaacaacacgaggacacaattttgttgtatgcattgaaagatctttttgaa
agcatggttgagaataaatcaacaataggagttgtctcgccatccttcttcatatccaag
cttaaagagaaaaactatttgtttagacaaaacaatatgcatcatgacgctcatgagttc
ttcaactatttaatcaatgaaatcatagaaagtctcaataaagagtccaagccaaattgg
tgcacagacttgtttcaaggattgatcacaaatgaaacaaagtgtttatcgtgcgaaaca
gttacatcgagacatgagcattttcttgatttatcaatagatataccaccaggcgaaaat
gcatactccttgaattatgcaatcaacaatttctcaaagtcggaaacgcttacaaatcaa
aataaatttcattgcaacacttgctcatcgcttcaggaagcagtcaagacgataaaggtc
aagaagctgcccaatgtacttgttatcaacttgaaacggttcaagtatgatgaaaaaatt
gacaaattggttaagctttttgattctattagctacccttttaaactaaggttgttcaac
actacagatgactgttttgaaaatatattgtatgagctttatgcattggtgatacatatt
ggaggcggtccaatgcatggacactatgtttctatctgcaaaatcaaagctggtctttgg
ttattatttgacgatgagacagtcgagttggtggaagacaattatgtaatgagatttttt
ggcaacggccctgggttggccagtgcatatattttgttttaccaaaagattgaatttgat
gagaatgcagagtattttggatttgatccggcaaccatgtttaatggaaaagattttgag
tttcccatgtcgtcgaataatgtggccgagtcatcatcagcctctgtcaacacatcaaca
gttgcatttacatcagctcctatggctccactggctgctgcaagtgctgcaagtgctgca
agtgttgcaagtgcaactatggctacaggacccggctcaactgcaacaagaacaagaacg
acgtcgacaggaaccacgggcaacggtgtggaacttgataataaaatagacacaacacca
actgatgactctgttgcaatgaaagctgatatagacaaaaaaccacctttatcctcagga
ggcatgtttaaaagtttcaagtttgaaaaagaagaaaaggcacaaactctttcgagaagt
aatagtactggagcctccacactccttcagaacaaccagcaaaatggcaaagatacaaag
agcaaaaagtcatggctcggtacattaaaaagaacaggtcttgagcggaaactatctggt
aaatcgccaactattgtggaagcccctaaagctgaaaaggaatctactgaagaggcccaa
cctgttgttgaacatgagtctacatcggctccagcgcccaaaggaggtcttgttaaatct
acatctcatgctcatgctcctgctcctattcctgctcctattcctgctcctattcctcct
ccttcacgtcccgctcaaatggaaaaaagacgaagtttgtttggatttaaaaaaaatgct
agttga

DBGET integrated database retrieval system