KEGG   Lodderomyces elongisporus: LELG_01310Help
Entry
LELG_01310        CDS       T01116                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lel  Lodderomyces elongisporus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lel00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MVHKAEFLPSTGNSISSILQGGYNHPLSREWQQERQLTKNMFIFPLFISDMPDDETDIPS
LPNIKRFGVNKLVPYVDSLVKKGLRAVILFGVPLKEGVKDSVGTAADDPEGPVITSIKLL
REKFPDLFIMCDVCLCEYTDHGHCGILNEDGSLNREPSVRRIAAVAVNYAKAGAHSVAPS
DMMDGRIKDIKTGLMDAGLAHKCLVMSYAAKFSGNLYGPFRDAAGSAPSHGDRKAYQLPP
AGAGLARRALLRDIEEGADAIMVKPSTFYLDIVSDASKLCGDYPLCAYHVSGEYAMLHAA
AEKGVVDLKGIAFEAHQGLVRAGARLIISYFTPEFLEWLDI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggttcacaaagcagaatttttaccttcgactggtaactcgatatcttccatattacaa
ggtggctacaaccatcctttatcgcgagaatggcagcaagaacgtcagttgaccaagaac
atgtttattttcccattattcatttcagacatgccagatgacgaaactgatattccctca
ttacctaatatcaagagatttggagttaacaaattggttccatacgttgactcgcttgtg
aaaaagggattgagagcagtaattctttttggagtacctttgaaagagggtgttaaggac
tctgtaggtacggcagcagatgaccctgaaggaccagtgattacaagtatcaagttatta
agagagaagtttcccgacttgtttataatgtgtgacgtgtgtttgtgtgaatatactgat
cacggacattgtggaatcttgaatgaagatggatcgttgaatagagaaccttctgtgcga
agaattgctgccgttgctgtcaattatgccaaagcaggtgcccactcagtagcaccttca
gatatgatggacggtagaattaaggatatcaaaacaggtttaatggatgcaggacttgca
cacaaatgtcttgttatgtcgtatgcagcaaaattttcaggaaacttgtacggaccattc
cgtgacgctgctggttcagcaccaagtcatggcgatagaaaagcatatcaattgcctcca
gcaggtgccggtttagcgagaagagcattgttgagagatatcgaagagggagcagatgct
ataatggttaaaccttcaacattctatttggatattgttagtgatgctagtaaactatgt
ggcgattacccactctgtgcttaccacgtgagtggtgaatatgccatgttgcatgcagct
gccgaaaagggagtggtggatttgaaaggcattgcttttgaagcacaccagggacttgtc
agagcaggtgctagactcataatcagttatttcacccctgaattcttggaatggttggac
atctaa

DBGET integrated database retrieval system