KEGG   Lodderomyces elongisporus: LELG_01317Help
Entry
LELG_01317        CDS       T01116                                 

Definition
mitogen-activated protein kinase HOG1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
lel  Lodderomyces elongisporus
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:lel00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    LELG_01317
Enzymes [BR:lel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LELG_01317
Protein kinases [BR:lel01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LELG_01317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 400 aa AA seqDB search
MSSDGEFTRTQIFGTVFEITNRYTDLNPVGMGAFGLVCSAVDKLTGQNVAVKKIMKPFST
SVLAKRTYRELKLLKHLRHENLITLDDIFISPLEDIYFVNELQGTDLHRLLTSRPLEKQF
IQYFTYQILRGLKYIHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDTEVDLWSVGCILAEIIEGKPLFPGKDHVNQFSIITELLGSPPPDV
IDTICSENTLRFVQSLPHRDPIPFSERFANCTHVEPEAIDLLEKLLVFDPKKRISAAEAL
THPYMEPYHDPTDEPVCETKFDWSFNDADLPVDNWRVMMYSEILDFHQSIGVGGSGMDQQ
QQEVADANGDTHKLEQYQQQQEQQVQQQQLQQQEQLQPQV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagatggagaattcacaaggacacagatctttggtactgtgtttgagatcaca
aatagatacacagacttgaaccccgttggtatgggtgcttttggtttggtatgttcagca
gtcgataaactaactggccaaaacgttgctgtaaagaagattatgaaaccattttcaacc
tctgtgttggccaagaggacatatagagagttgaaattattgaaacacttgagacatgag
aatttaatcaccttggacgacattttcatctcccccttggaagatatttactttgtgaat
gagttgcaaggtacagatttgcaccgattattgacatcgagaccattggagaaacaattt
atacaatactttacataccaaatcttgagaggattgaaatatatccattcggctggtgtc
attcatcgtgacttgaaaccatccaacattctcatcaatgaaaattgtgacttgaagatt
tgtgatttcgggttagccagaatccaggaccctcaaatgacgggatatgtctccactaga
tactatagagcaccggaaattatgttgacttggcaaaaatacgacaccgaggttgacttg
tggtctgtgggatgtatcttggccgagattattgaaggcaagccattattcccaggtaaa
gatcacgtaaaccagttttcaattattaccgaattgttgggaagcccaccccctgatgtc
attgacacaatctgctctgaaaacactttgagatttgtgcaatcattaccacatagagac
ccaatcccattcagtgagagattcgccaactgcacacatgttgagccagaagctattgac
ttgttggagaaattgcttgtgtttgacccaaaaaagagaatcagtgctgctgaagcctta
acacacccatacatggagccataccacgacccaaccgatgagcctgtatgtgagaccaag
tttgactggagtttcaacgatgccgatttgccagtagataactggagagtcatgatgtac
agcgagattttagatttccatcagagcattggtgtaggaggaagtggaatggaccagcaa
cagcaggaagttgcagatgccaatggtgatacacataaattagagcagtatcaacaacag
caggaacagcaggtccagcagcaacagctccagcagcaggaacaacttcagccacaagtg
taa

DBGET integrated database retrieval system