KEGG   Lodderomyces elongisporus: LELG_01667Help
Entry
LELG_01667        CDS       T01116                                 

Definition
acetyl-coenzyme A synthetase 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LELG_01667
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_01667
   00620 Pyruvate metabolism
    LELG_01667
   00640 Propanoate metabolism
    LELG_01667
  Energy metabolism
   00680 Methane metabolism
    LELG_01667
Enzymes [BR:lel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LELG_01667
Lipid biosynthesis proteins [BR:lel01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LELG_01667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 675 aa AA seqDB search
MASTENHTVVHEANGVPFRATPKEFFERQPSSGGHLKDIDHYRELYEKSINDPQGFFGPL
AKEMLSWDRDFHTIKSGTLKEGNAAWFLGGQLNASYNCVDRHALKNPNKPALIYEADEDS
DSYIITYGELLKEVSRVAGVLQSWGVGNGDTVAVYLPMNAQAIIAMLAITRLGAAHSVIF
AGFSSGSIKDRVNDAQCKALITCDEGKRGGRVTNIKRLCDDALESCPSVKHVLVHKRTNN
KEIAMKEGRDFYWDEETVKFPGYLPPVSVDSEDPLFLLYTSGSTGTPKGVVHTTAGFLLG
AALTTKYVFDVHEEDILFTAGDVGWITGHTYALYGPLLLGIPSIIFEGTPAYPDYGRFWH
IVQKHRATHFYVAPTALRLLRKAGQEEIKKYDISSLRTLGSVGEPISPDIWEWYNEYVGK
DQCHISDTYWQTESGSHLIAPLAGITPNKPGSASYPFFGIETALIDPVSGAEIKGNDVEG
VLVVKDHWPSMARTVYHNHTKYMDTYMNPYPGYYFTGDGAARDHDGYYWIRGRVDDVVNV
SGHRLSTAEIEAALIEDQKVGEAAVVGINDDITGQAVIAYVALKDSNTEQTEEDLLTLRK
ELVLIVRKSIGPFAAPKAVIVVADLPKTRSGKIMRRILRKISSNEADQLGDITTLQNPQS
VEGIVKSFAAQYGKK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaactgaaaatcatactgttgtgcacgaggcaaatggcgtgccctttagagct
actccaaaggaattctttgaaagacaacctagctcaggtggccatttaaaagacattgac
cattaccgtgaactctatgagaaatccatcaatgatcctcaaggattctttggcccattg
gctaaggaaatgttatcatgggacagagacttccacaccatcaagtctggtactttgaaa
gaaggcaatgccgcatggttcctcggaggccaattgaatgcctcatacaattgtgtcgat
agacacgccttaaagaacccaaacaagccagctttgatttatgaggccgacgaagatagc
gactcatacattatcacttatggagaattgttgaaggaagtttccagagtcgctggtgtc
ttgcaaagctggggtgtgggtaacggtgacaccgttgctgtctatttgccaatgaatgcc
caggccattatcgccatgttggccatcaccagattgggtgcagcacactcggtgattttt
gccggtttctcttcaggctcgatcaaggacagagtcaatgacgcccaatgtaaagcattg
attacttgtgacgaaggtaagagaggtggaagagtcacaaacatcaagagattgtgtgac
gatgctttggagagctgtccaagcgttaaacatgtcttggtccacaagagaaccaacaac
aaggagattgcaatgaaggaaggaagagatttctactgggacgaggaaaccgttaagttc
ccaggttacttgcctcccgtatcagtagactctgaagacccattgtttttgctttatact
tcgggctcaaccggtactccaaagggtgttgttcacaccaccgctggtttccttttggga
gcagcattaaccaccaagtacgtgtttgacgttcacgaagaggatattttgttcaccgca
ggtgacgttggttggatcactggccacacttatgccttgtatggaccattattgctcggt
atcccatcaatcatctttgaaggtaccccagcatacccagactatggtagattctggcac
attgtgcaaaaacacagggcgacacacttttacgttgcccctacagcattgagattattg
cgtaaagcaggccaagaggagattaagaagtacgacatctcctcattgagaaccttgggt
tcagttggagaaccaatctcaccagatatctgggaatggtacaatgaatatgtcggtaag
gatcaatgtcacatttcagacacttattggcaaaccgagtctggatcccacttgattgcc
ccattggctggtattacaccaaacaagccaggatctgcatcatacccattctttggtatt
gaaactgcattgattgatccagtctctggtgctgagattaaaggcaatgacgttgaaggt
gtcttggtggttaaggaccactggccatcaatggctagaactgtttaccacaaccacacc
aagtatatggacacatatatgaatccatacccaggctactatttcaccggtgacggtgct
gctagagaccatgatggttactactggatcagaggtagagtcgatgatgttgtcaatgtc
tctggccacagattatccaccgctgagattgaagctgcgttgattgaagaccaaaaagtt
ggtgaggcggctgtcgttggtatcaatgatgacattaccggtcaagctgtgattgcatat
gttgcattaaaggactccaacaccgagcaaacagaagaagatctcttgaccttgagaaaa
gaattggtcttgattgtgagaaaatctattggtccatttgccgcacccaaggctgtgatt
gttgttgcagacttgccaaagacaagatcgggtaagattatgagaagaatcttgagaaag
attagttcgaacgaagccgaccagctaggcgacattaccactttgcaaaacccacaatcg
gtggaaggtattgttaagtcctttgctgctcaatacggaaagaaataa

DBGET integrated database retrieval system