KEGG   Lodderomyces elongisporus: LELG_01671Help
Entry
LELG_01671        CDS       T01116                                 

Definition
(RefSeq) similar to phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lel  Lodderomyces elongisporus
Pathway
lel00010  Glycolysis / Gluconeogenesis
lel00260  Glycine, serine and threonine metabolism
lel00680  Methane metabolism
lel01100  Metabolic pathways
lel01110  Biosynthesis of secondary metabolites
lel01130  Biosynthesis of antibiotics
lel01200  Carbon metabolism
lel01230  Biosynthesis of amino acids
Module
lel_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lel_M00002  Glycolysis, core module involving three-carbon compounds
lel_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_01671
  Energy metabolism
   00680 Methane metabolism
    LELG_01671
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LELG_01671
Enzymes [BR:lel01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LELG_01671
Membrane trafficking [BR:lel04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LELG_01671
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LELG_01671
  Exosomal proteins of melanoma cells
   LELG_01671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 NapB
Motif
Other DBs
NCBI-GeneID: 5234023
NCBI-ProteinID: XP_001526843
UniProt: A5DWD5
AA seq 255 aa AA seqDB search
MAIHKLIILRHGESQWNHENKFCGWIDIPLTDKGKDEAKYAGELLKQNNLSPDILYTSKL
IRSIETGFIILKVLGKPWVDHIKSWRLNERHYGQYQGRDKHQVFQELGSDKEKFQFIRRD
YHGTPPLIPLDENDPSIDEKYNDLLNQNILPRGESLSMVMDRLIPFFKYEIMDHQMVQLN
KTVLIVTHGSVVRSLIKYLNKVSDEDISKINVPTGVPLVFELDDRGELVKPYYYLDKEKA
EKGMEKVKNEGLLLK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctattcacaagttgatcattctccgtcatggggaatcgcaatggaatcacgaaaat
aagttttgtggatggatagacatcccgcttacagacaagggtaaagacgaagcgaagtat
gccggcgaattactcaagcagaataatttatcgccggatatactatatacatcaaaattg
attcgatcgattgagacagggtttattattttaaaagtcttgggaaaaccttgggttgac
catatcaagtcatggaggttaaatgagcgtcactatggccagtatcaaggtcgtgataag
caccaagtttttcaggaattgggatcggataaggagaagtttcaatttattagaagagat
tatcatggcacgccaccattgatccctttggacgaaaatgacccgagcattgatgagaag
tacaatgacttgttgaatcaaaatatattaccacgaggtgaaagcttgagtatggtgatg
gatcggcttattccgttcttcaaatacgagataatggatcatcagatggtgcaattgaac
aaaacggtattaattgtgacacatggcagtgttgtaagaagcttaataaagtatttgaac
aaggttagtgatgaagatattagcaagatcaatgttcccacaggtgtaccgctagtgttt
gagttggatgatagaggtgagcttgtaaagccatattattatttggataaagaaaaagcc
gaaaaggggatggaaaaagtaaagaatgaaggattgctgctgaaataa

DBGET integrated database retrieval system