KEGG   Lodderomyces elongisporus: LELG_01671Help
Entry
LELG_01671        CDS       T01116                                 

Definition
similar to phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lel  Lodderomyces elongisporus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LELG_01671
   01230 Biosynthesis of amino acids
    LELG_01671
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LELG_01671
  Energy metabolism
   00680 Methane metabolism
    LELG_01671
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LELG_01671
Enzymes [BR:lel01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LELG_01671
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LELG_01671
  Exosomal proteins of melanoma cells
   LELG_01671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 255 aa AA seqDB search
MAIHKLIILRHGESQWNHENKFCGWIDIPLTDKGKDEAKYAGELLKQNNLSPDILYTSKL
IRSIETGFIILKVLGKPWVDHIKSWRLNERHYGQYQGRDKHQVFQELGSDKEKFQFIRRD
YHGTPPLIPLDENDPSIDEKYNDLLNQNILPRGESLSMVMDRLIPFFKYEIMDHQMVQLN
KTVLIVTHGSVVRSLIKYLNKVSDEDISKINVPTGVPLVFELDDRGELVKPYYYLDKEKA
EKGMEKVKNEGLLLK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctattcacaagttgatcattctccgtcatggggaatcgcaatggaatcacgaaaat
aagttttgtggatggatagacatcccgcttacagacaagggtaaagacgaagcgaagtat
gccggcgaattactcaagcagaataatttatcgccggatatactatatacatcaaaattg
attcgatcgattgagacagggtttattattttaaaagtcttgggaaaaccttgggttgac
catatcaagtcatggaggttaaatgagcgtcactatggccagtatcaaggtcgtgataag
caccaagtttttcaggaattgggatcggataaggagaagtttcaatttattagaagagat
tatcatggcacgccaccattgatccctttggacgaaaatgacccgagcattgatgagaag
tacaatgacttgttgaatcaaaatatattaccacgaggtgaaagcttgagtatggtgatg
gatcggcttattccgttcttcaaatacgagataatggatcatcagatggtgcaattgaac
aaaacggtattaattgtgacacatggcagtgttgtaagaagcttaataaagtatttgaac
aaggttagtgatgaagatattagcaagatcaatgttcccacaggtgtaccgctagtgttt
gagttggatgatagaggtgagcttgtaaagccatattattatttggataaagaaaaagcc
gaaaaggggatggaaaaagtaaagaatgaaggattgctgctgaaataa

DBGET integrated database retrieval system