KEGG   Lodderomyces elongisporus: LELG_01686Help
Entry
LELG_01686        CDS       T01116                                 

Definition
histone H2B.1
Orthology
K11252  
histone H2B
Organism
lel  Lodderomyces elongisporus
Brite
Exosome [BR:lel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LELG_01686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 131 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTASSTDGGKKRTKARKETYSSYIYKVLKQTHPDTGIS
QKAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREVQTAVRLILPGELAKHAVSEGT
RAVTKYSSAQN
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaagctgaaaagaaacctgcttcaaaagctcctgctgaaaagaaaccagcc
gctaaaaagactgcttcctcaaccgatggtggtaagaagagaaccaaggctagaaaggaa
acctactcatcatacatttacaaggttttgaaacaaacacacccagacactggtatctca
caaaaggctatgtccatcatgaactcctttgtcaatgacatctttgagagaattgcttct
gaagcttccaaattggctgcttacaacaagaaatcaaccatctctgctagagaagtccaa
actgctgtgagattgatcttgccaggtgaattggctaagcacgctgtttctgaaggtact
agagctgtcaccaagtactcctcagctcaaaactaa

DBGET integrated database retrieval system