KEGG   Lodderomyces elongisporus: LELG_01738Help
Entry
LELG_01738        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
lel  Lodderomyces elongisporus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1602 aa AA seqDB search
MENNMTNLTTTAGTAGTTRGVGSGSGFGSESRSEQESKQTVTGARVGPLSRVVVSTPNPV
APHLLNGDGRPAFQLNDKMRHGFDDDYNSENFLNTLANTFYIYYDDKRQITNGNPITPEM
KMMPKYYKNYQPIYDWKVMKERQKTISAVLVLCLNLGVDPPDVMKTYPCAKFEAWCDPTT
FTDTKKALENIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCNTLRRNAKDERILFHYN
GHGVPQPTTSGEIWVFNRGYTQYIPISLYDLQTWLGAPVIFVYDCNSAGNIIQNFKKFVQ
KRIDDDNDGNHDQSAPSPTSAYLDCIQLAACKSNELLPMSPDLPADLFTCCLTCPIDISV
TWFIMQSSMRKNYYDQLPRNQIGNVIIPGKLTDRRTPLGELNWIFTAITDTIAWTSLSRP
IFKRLFRQDLMVAALFRNFLLAKRIMPLLNCNPISDPPLPDVVKYHPMWDSWDLAIDQVL
SQLLKTTEDGGGKTTDNASLQSAVSNNEKSAASAAANVRNGSTSSLTSVPTQNGSHHNQN
QNQNQNQNQNQNQNQNHSGGSSTVAGQNLGNYQHSTFFEQQLTAFEIWLKYAGPSTKEPP
EQLPIVLQVLLSQVHRLRALILLSKFLDLGPWAVYLSLSIGIFPYVLKLLQSPAQELKPV
LIFIWARIMAIDYKGTQQELCKDKGYNYFYLILNSLSGTPGNSANTTTVALNGTSSGPLL
INDDHKAMSAFILTLFMRDFKNGQRLCFSTELIGNCIKLISISENPLLRQWCCLLLSQLW
NKYPDGKWAAYKDGYVTELYMLLNDPIPEVRTSIILALTTFITEPTLSLGIGQQLLQLLQ
LQPAAPNGTAMDAKKDEMRQQDLKLANVLLGLLGDGSPIVRRELVFFISKFIQTYFKFFL
IVAFNQLEEEIVLLDDPNSLNEFRKKSPAYGSIFSSVWKALLILSEDPHCEIKQLAETLI
DFVMFKLNESELAPLVVDMQSFLLSKSSIEIDSFQVHQPQKPILAGRKPLNDSKRQTSSA
SVINRKNNLRIEGSSLMTATTTTRAASSSFAGQGLDNNSSSDTESITSKIKNFSISKLFK
SFHLNEETDLPNFTRMLRAGPIQVGYGAEYKPRSAFFVERDLSNPPSMPSHSGFFDYSCE
YFQEPQMSKNEIDEPGSKEYIKRLWRRNRNEAIIQKTQPQKEMAVRGDWNADIKILNNIV
QPKCIRFTQFEKILVASDEKDNLTVWDWDAGVVVKKFSNGNPFGTKITDIKFLNEDDQSL
LLTGSSDGVVKIYKNFHTNENGNEEEYGNNNEDDYVDDDDDDDDEGEMKMKMKKGGKEIR
KSINGGDMGVAIKDVSGRTTSRIEGKKKNNGVELVTGWRALTDLLLTAKSSGLVSEWQQS
RGSLLVSGDVKVIRIWDAPRELCLLDIPARSSSSITSLTSDQVAGNVFFAGFDDGSIRVY
DRRLDSRESMVRVWKLGRQQPNSQNDCQFGYGSIRNVHMQRGGFRELVSGSSDGFVNLWD
IRLNDPVMTYTTPDKQIRSMDVHEHAPVLTTGSKSVRMWSTGGTDLATLRNISQESKYLS
SGRGINYVSSTTFHPHHMMLATNNTQDSNICIYNCRDVVVEY
NT seq 4809 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaacatgactaatttgacaacaacagcaggaacagcgggaacaacgagagga
gttggatccggatccggatttgggtccgaatccaggtctgagcaagaatcaaaacaaaca
gtgaccggagcaagggtagggccactgtctagagtagttgtatcaacacccaacccagtg
gctcctcatttattaaatggagatggacgaccggcctttcagttgaacgacaagatgaga
cacgggtttgatgacgattacaattctgagaattttctcaacactcttgcaaacacattt
tatatatactacgacgacaaacgccagattacaaatggtaacccaattactccagaaatg
aaaatgatgccaaagtattacaaaaattaccaaccaatatatgactggaaagtcatgaaa
gaacgacaaaaaactataagcgcagtccttgtgctttgtctaaacttaggagttgaccca
ccagatgtaatgaagacatacccctgtgccaaattcgaagcatggtgcgaccctacaact
ttcacagatacaaaaaaggcacttgaaaacattggcaaaaatttacaatctcagtatgaa
accttgtctttgcgaacccgatataagcaatccttggatccgtgtgttgaagatgtcaag
agattttgcaacactctacgaagaaacgccaaggatgaacgaatcttgttccattacaac
ggacatggtgttccgcaacctactacaagtggagaaatatgggtctttaatcgaggatat
acgcaatatattccaatatccttatacgacttgcaaacttggctaggcgcgcccgtaata
ttcgtatacgattgcaatagtgctggaaatataatccaaaactttaagaaatttgttcaa
aaaagaatagacgatgataacgatgggaaccatgaccaaagtgcgccatcacccacgtca
gcataccttgattgcattcaattggctgcttgtaaaagcaatgagcttttaccaatgagc
ccagatttaccagctgatctatttacttgttgcttaacttgtccaattgatattagtgtc
acttggttcataatgcaaagctcaatgaggaaaaattactatgatcaacttcctaggaat
cagatagggaatgttattattccgggaaaactaactgatcgaagaacccctttgggagaa
ttgaattggatctttactgcaatcacagacacaattgcatggacatcgttgtcgagacca
atttttaagaggcttttcagacaggatcttatggttgctgcattgtttagaaacttcttg
cttgccaagaggataatgccacttttaaactgcaatcctatcagcgacccaccattgcca
gacgtggtcaagtatcatccaatgtgggactcttgggatttggctattgatcaagtactt
tctcagctcttgaaaactacggaagatggaggtggaaaaactactgataatgcatctctg
caatcagctgtatccaataacgagaaatcggcggcttcagcagcagctaatgttcgtaat
ggttcaacttcctcattaacttctgtaccaacgcaaaatgggtcacatcacaatcaaaac
caaaaccaaaaccaaaaccaaaaccaaaaccaaaaccaaaaccagaatcatagtggtggc
tcttctactgttgctggacagaatttgggcaattaccaacactcaacattttttgagcaa
cagcttacagcttttgagatttggttgaaatatgctggaccatccaccaaagagccacca
gaacaattacctatagtgttgcaagtgcttttatcacaggtccacaggttaagagctttg
atattgttgtcgaaatttcttgatcttggtccttgggcagtttatctatcattgtctatt
gggatattcccatacgtgttgaagcttttgcaaagtcccgctcaagagttaaagccggtt
ttaatttttatttgggcacgaattatggcaattgattataaaggaacacaacaagaatta
tgcaaggataagggctacaattatttttacctgatcttgaactcgctgtccggtacacca
ggtaactctgcaaataccacaactgtcgctttaaatggcacgagctctggtcctttacta
attaatgatgatcacaaggccatgagtgcatttatattgactttgtttatgagggatttt
aaaaatggacaaagactctgtttttccacggaattgattggcaattgcataaagctcatt
tcgattagtgaaaatccgttgcttagacaatggtgctgtttgcttttatcgcaattgtgg
aacaaatatcccgatgggaaatgggctgcttataaggatggttatgttactgagttgtac
atgttgttaaatgatcccattccggaggtgcgcacttcgatcatcttggcactaacaaca
tttattactgagcctacattaagcttggggattggacagcaactgctgcaactgctgcaa
ctgcaacctgcagcacctaatggtacagctatggatgctaaaaaggatgagatgaggcag
caagatttgaaacttgccaatgttttgcttggattgttaggtgatggttcacctattgtt
cgtcgagagttggtatttttcatcagcaaattcattcaaacatatttcaaatttttcctt
attgtagcttttaatcagctcgaggaggaaattgtgttattggatgatccaaattcatta
aatgaatttcggaaaaagtcacccgcttacggttcgattttcagctcagtttggaaagca
ttacttattctttcggaagacccacattgtgaaataaagcaattagctgagactttgatt
gattttgtgatgttcaaactaaatgaaagcgagttggctcctttggtggtagatatgcaa
agctttttattgagcaagtcgtcgattgaaatcgatagtttccaagtgcatcaaccccag
aagcctattcttgcgggtaggaaacctttaaatgactcgaaacgacaaacttccagcgca
tctgtgatcaatagaaagaacaatttgcgcattgagggctcttcattgatgacggcaaca
acgacgacaagggctgcatcgtcatcttttgcgggtcaaggtctggataataattcttct
tctgatacagagtccattacttcaaagattaaaaatttttccatatcgaaacttttcaaa
agttttcaccttaacgaagagacagatttaccaaattttacacgtatgttgagagcagga
ccaatacaagtgggctatggtgctgagtacaaaccaagatcggctttttttgttgaaagg
gacttgtcaaatccaccctcgatgccttctcattctggattttttgactatagttgcgag
tattttcaagaaccacaaatgtctaaaaacgaaatcgatgaacctggttcaaaagagtat
atcaagaggttgtggaggcgtaacaggaatgaagcaatcattcaaaagacgcaacctcaa
aaggaaatggctgtgagaggagactggaatgcggatatcaagatattgaacaacattgtt
caacccaaatgtattagattcacgcaatttgaaaagattctagttgctagtgatgaaaaa
gataatcttacagtttgggattgggatgccggagttgtggtgaagaaattctcaaatggg
aatccatttggtaccaaaattacagacataaaatttttaaatgaagatgatcaatccttg
ctactcactggctcttctgatggagttgtgaaaatttataaaaatttccatacgaatgaa
aatggcaatgaagaagaatatggtaataataatgaggatgattatgttgatgatgatgat
gatgatgatgacgagggggagatgaagatgaagatgaagaagggtggaaaggagattaga
aagtcgatcaacggtggtgatatgggagttgcaataaaggatgtaagtggcagaacaaca
tcccgaattgagggcaagaagaagaataatggggttgaattggttacagggtggcgtgca
ttaactgatttgcttcttactgcaaaaagttcaggtttagtgtcggaatggcaacagtca
agaggttcattacttgttagtggagatgttaaagttattcgaatttgggatgcgcctcgt
gagctttgtttactggatataccagcgcgatcttcttcctcgattacatccttaacatcg
gatcaagtcgctggtaacgttttttttgctggatttgacgatggaagtatccgagtttat
gatagaaggttggattcacgtgaatcaatggtgagagtatggaagctgggaagacaacaa
ccaaatagtcaaaatgattgtcaatttggatatgggtcgattcgtaatgtccatatgcaa
cgaggtgggtttagggaacttgtaagtggttcttccgatggatttgttaatctttgggat
atcagactcaatgatccagttatgacatatacaactcctgataaacaaataagaagcatg
gatgtgcatgagcatgcgccagtcttgaccacggggtccaaatctgtaagaatgtggtca
acaggggggacagacttggcgacattgagaaacatttcgcaagagagcaaatacctaagt
tctggtcgtggtatcaattatgtttccagtacaacctttcatccacaccatatgatgctt
gcaaccaacaatacccaagactccaacatttgcatatacaactgcagagatgtagtcgta
gaatattga

DBGET integrated database retrieval system