KEGG   Lodderomyces elongisporus: LELG_01800Help
Entry
LELG_01800        CDS       T01116                                 

Definition
(RefSeq) similar to histone acetyltransferase
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LELG_01800
Chromosome and associated proteins [BR:lel03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    LELG_01800
   HAT complexes
    HATB complex
     LELG_01800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hat1_N Acetyltransf_1 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 5234613
NCBI-ProteinID: XP_001526971
UniProt: A5DWR3
AA seq 423 aa AA seqDB search
MSSSDQKPISAAALQPETWTASSNDALKLFVTNEDEAINFRPVFTYPIFGDAETIYGYKD
LCIFLCFDHYTFKPFLNVKFAEKLDDSDLIDIKETMMKYLPQDTIYKDEIRWVDSIKDEK
EKYEIPGEKVDSFKADNLTYEIYKINLKLAQGLELHKRLQVLVLLYIEAGSFIDAEDELW
DVYVLYERVEGESEPSVAGFATAYNYWRYPGSAKFDAGETEVRMKISQFIILPMYQGKGL
GQAFYTHLYSYWLTKSDVVEIVVEDPNEAFDDMRDRADLKKLAETDLGFDLSKVVANNID
KVWVDETRKKLKLEKRQFSRLLEMVLLYKLKHHLGNISKPDVRKFIKTRLYKKNKEGLDG
LEENDRKDKLQTAYQALEEDYFRILGDVKLGLNKRKVEAGEDQHGNNNNNNSNSSKKKKV
NGV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccagtgatcagaaaccaatatctgctgctgcgttgcagcctgaaacatggact
gcatcatcaaacgatgcactcaagctatttgtcacgaatgaagatgaggcgatcaatttc
cgtccggtgtttacatatcccatctttggcgatgcagaaacgatttacgggtataaggat
ctttgcatttttttgtgttttgaccattatacttttaagccttttttgaatgttaagttt
gctgagaaactagacgattctgacttgattgatattaaggagacaatgatgaagtacttg
ccccaggacaccatctataaggacgagatccgatgggtggactcaatcaaggatgagaag
gaaaagtatgagattcctggcgaaaaagttgactcatttaaagctgacaacttgacttat
gagatttataagatcaacttgaagctggcccaggggttggagttgcataaacgacttcag
gttttggtcttgctctatattgaagctggctcattcattgatgccgaggacgagctctgg
gatgtttatgtgttgtatgaaagagttgagggtgaaagtgaaccatcagttgctgggttt
gctaccgcatataattactggagataccctggatctgctaaatttgatgccggggagacc
gaggtgcggatgaaaatttcgcagtttattatactacctatgtaccagggcaagggactt
ggtcaggctttttacacacatttgtatagttattggttaacgaaaagtgatgttgttgaa
attgttgttgaagatcctaatgaggcgtttgacgatatgagggatagagcagatttgaag
aaattggcggagacagatctggggtttgatttgagcaaagtagttgcaaacaatatcgac
aaggtatgggttgatgagacgagaaaaaagttgaagcttgaaaaaaggcaattttcgaga
ctattggagatggtattgttatacaagttgaagcatcatttggggaacatttctaaaccc
gatgtgcgtaagtttataaagacgcggttatacaagaagaacaaggaagggttggatggt
ttagaagagaatgatagaaaggataagttgcagactgcgtaccaggcattggaagaggat
tactttagaatacttggcgatgtgaaactaggtctgaataagcgaaaagtagaagctggt
gaagatcaacatggtaacaacaacaacaacaacagcaacagtagcaaaaagaagaaggtg
aacggtgtataa

DBGET integrated database retrieval system