KEGG   Lodderomyces elongisporus: LELG_01800Help
Entry
LELG_01800        CDS       T01116                                 

Definition
similar to histone acetyltransferase
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LELG_01800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MSSSDQKPISAAALQPETWTASSNDALKLFVTNEDEAINFRPVFTYPIFGDAETIYGYKD
LCIFLCFDHYTFKPFLNVKFAEKLDDSDLIDIKETMMKYLPQDTIYKDEIRWVDSIKDEK
EKYEIPGEKVDSFKADNLTYEIYKINLKLAQGLELHKRLQVLVLLYIEAGSFIDAEDELW
DVYVLYERVEGESEPSVAGFATAYNYWRYPGSAKFDAGETEVRMKISQFIILPMYQGKGL
GQAFYTHLYSYWLTKSDVVEIVVEDPNEAFDDMRDRADLKKLAETDLGFDLSKVVANNID
KVWVDETRKKLKLEKRQFSRLLEMVLLYKLKHHLGNISKPDVRKFIKTRLYKKNKEGLDG
LEENDRKDKLQTAYQALEEDYFRILGDVKLGLNKRKVEAGEDQHGNNNNNNSNSSKKKKV
NGV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccagtgatcagaaaccaatatctgctgctgcgttgcagcctgaaacatggact
gcatcatcaaacgatgcactcaagctatttgtcacgaatgaagatgaggcgatcaatttc
cgtccggtgtttacatatcccatctttggcgatgcagaaacgatttacgggtataaggat
ctttgcatttttttgtgttttgaccattatacttttaagccttttttgaatgttaagttt
gctgagaaactagacgattctgacttgattgatattaaggagacaatgatgaagtacttg
ccccaggacaccatctataaggacgagatccgatgggtggactcaatcaaggatgagaag
gaaaagtatgagattcctggcgaaaaagttgactcatttaaagctgacaacttgacttat
gagatttataagatcaacttgaagctggcccaggggttggagttgcataaacgacttcag
gttttggtcttgctctatattgaagctggctcattcattgatgccgaggacgagctctgg
gatgtttatgtgttgtatgaaagagttgagggtgaaagtgaaccatcagttgctgggttt
gctaccgcatataattactggagataccctggatctgctaaatttgatgccggggagacc
gaggtgcggatgaaaatttcgcagtttattatactacctatgtaccagggcaagggactt
ggtcaggctttttacacacatttgtatagttattggttaacgaaaagtgatgttgttgaa
attgttgttgaagatcctaatgaggcgtttgacgatatgagggatagagcagatttgaag
aaattggcggagacagatctggggtttgatttgagcaaagtagttgcaaacaatatcgac
aaggtatgggttgatgagacgagaaaaaagttgaagcttgaaaaaaggcaattttcgaga
ctattggagatggtattgttatacaagttgaagcatcatttggggaacatttctaaaccc
gatgtgcgtaagtttataaagacgcggttatacaagaagaacaaggaagggttggatggt
ttagaagagaatgatagaaaggataagttgcagactgcgtaccaggcattggaagaggat
tactttagaatacttggcgatgtgaaactaggtctgaataagcgaaaagtagaagctggt
gaagatcaacatggtaacaacaacaacaacaacagcaacagtagcaaaaagaagaaggtg
aacggtgtataa

DBGET integrated database retrieval system