KEGG   Lodderomyces elongisporus: LELG_01826Help
Entry
LELG_01826        CDS       T01116                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
lel  Lodderomyces elongisporus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LELG_01826
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LELG_01826
Enzymes [BR:lel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     LELG_01826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 547 aa AA seqDB search
MAYTKIDTNQEEKDFQKEVAEVKKWWSEPRWRKTKRIYSAEDIVKKRGTLKIDYPSSQQA
DKLFALLEKHDADKSASFTFGALDPIHVAQMAKYLDSIYVSGWQCSSTASTSNEPSPDLA
DYPMDTVPNKVEHLWFAQLFHDRKQREERLTMTKEEREKTPYIDFLRPIIADADTGHGGI
TAIIKLTKLFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQEHINRLVAIRASADIFGS
NLLAVARTDSEAATLITSTIDHRDHYFIAGSTNPEAGDLATLMAEAEAKGIYGDELARIE
TEWTKKAGVKLFSEAFVDEVKNGSYSNKDQLIKKFTDKVTPLSHTSNKEARKLARELLGK
DIYFNWDASRAREGYYRYIGGCQCAVMRGRAFAPYADLIWMESALPDYAQAKEFADGVKS
AVPDQWLAYNLSPSFNWNKAMPADEQETYIKRLAKLGYVWQFITLAGLHTTALAVDDFAN
QYSQIGMKAYGQQVQKPEIEKGVEVVKHQKWSGATYIDGLLKMVTGGVSSTAAMGAGVTE
DQFKDKH
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacaaagatcgatactaatcaagaagaaaaggactttcaaaaagaagtcgct
gaagttaaaaagtggtggtcagagccaaggtggagaaagaccaagagaatctactcggca
gaggacattgttaaaaagagaggtaccttgaagattgactacccatcttctcaacaagct
gacaaattgtttgctcttttggaaaagcatgacgctgacaagagtgcttccttcactttt
ggtgcattggacccaatccacgttgctcaaatggccaaatacttggattccatctacgtt
tccggatggcaatgttcttctactgcatcaacctcaaacgagccaagtcctgatttggca
gattacccaatggacactgttccaaacaaggtggaacacttgtggtttgctcagttgttc
cacgacagaaagcaaagggaggaaagattgacaatgaccaaagaagagagagaaaaaacc
ccatacattgactttttaagaccaatcattgctgatgctgatactggtcacggtggtatt
accgccatcattaagttgaccaagttgtttattgagagaggtgctgccggtatccacatt
gaagatcaagctccaggtaccaaaaagtgtggtcacatggctggtaaggtgttggttcct
gtgcaagaacacattaacagattggttgccattagagcatctgccgatatctttggctcc
aacttgttggctgttgccagaaccgactctgaagctgctactttgattacttcaaccatt
gaccacagagaccactactttattgcaggttcaaccaacccagaggctggcgatttggct
acattgatggctgaggctgaagcaaagggtatctatggtgacgaattagctcgtattgaa
actgagtggaccaagaaggctggtgtcaagttgtttagcgaagcttttgttgatgaagtt
aagaatggttcatactcaaacaaggaccaattgattaagaaattcacagacaaggttacc
ccattgagccatacttcaaacaaggaggctagaaaattggctagagaacttcttggtaag
gatatttactttaactgggatgcctcaagagctagagaaggttactacagatatattggt
ggatgccaatgtgcagttatgagaggtagagcatttgcaccatacgctgacttgatttgg
atggagtcagccttgccagactatgctcaagctaaggagtttgctgacggtgttaaatct
gcagttccagaccaatggttggcttacaatttgtctccatcatttaactggaacaaggct
atgccagctgatgagcaagaaacttatatcaagagattggccaaattgggttatgtatgg
caatttattactttggctggtttgcacactactgcattggctgtggatgattttgctaac
caatactctcaaattggtatgaaggcttatggccaacaggttcaaaagccagaaattgaa
aagggcgttgaagttgttaagcatcaaaaatggtctggtgctacatatattgatggtttg
ttgaagatggtcactggtggtgtttcttcgactgctgctatgggtgctggtgtcactgaa
gaccaattcaaagacaaacattaa

DBGET integrated database retrieval system