KEGG   Lodderomyces elongisporus: LELG_01864Help
Entry
LELG_01864        CDS       T01116                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase 4
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
lel  Lodderomyces elongisporus
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:lel00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 779 aa AA seqDB search
MSQAVRKRNTATKKQSNSDSTVFGGDDKNSNYKNNNINNSNNKVNDEFDDNNGKLKSGVG
LDKDPEQKYWLALVFVTILAIYTRFTKLGTPNKVVFDEVHFGKFASYYLERTYFFDLHPP
FAKLLIAFVGWLVGYNGKFKFDAIGDSYIENNVPYIAYRSLLAIQGTAIIPVMFLTMKTL
GFNVAACLLSSIIVCFDNAQVADSRLILLDATLILSVAATIFCYSKFSIYRKQPFTQKWW
KWLISTGVSLSCVISTKYVGVFTFFTIGIAVLHELWFLLDYRKGLTLQQFGKHFFARLWA
LIILPFTIYLFWFYLHFAILTKSGPGDAFMSAEFQETLLESPLAQHSKDVQYYDEITIKH
KDTGAFLHSHLHDYPLRYEDGRISSNLQQVTCVIEDDAKNDENNVWQIVPVIAEDDGKKG
KSVFTNDVVRFKHKGTGGFLLTHDVASPLKATNEEFTVVYNETASNRYNETLFRLRLNVP
GSNPKKQNQRKKVSTMATELRILHMDTVVAMWTHDDELLPEWAFQQQEVSGNKKIQDKDN
IWTFDSITNLAEHDSRSKYIPKKIKKIPFLKKWWELQGLMFHHNNQLSSSHPFASQPDAW
PLALSGVSFYNNNEEKKQIFFHGNVIGFWLEVCFLSVYVGILLADQITLRRNYHLLNDKA
RSRLYNTLGFLFIGWAAHYLPFFLMNRQKFLHHYLPAHLIAALFTGGLVEFICTNNSNDF
NRSSPQSKKIKMTVLVSLASIGIIWFFFYFRPITYGDVSLTPAEVQKRQWLDIKLHYAK
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagccgtgaggaaaagaaatacggctactaagaaacagtccaactcggattca
actgtgtttggcggcgacgacaagaacagcaactacaaaaataacaacattaacaacagc
aacaacaaagtcaatgacgaatttgatgacaataacggtaaactcaaaagtggggtgggc
ctcgataaagatccagaacaaaaatactggttggcgctagtgtttgttacaatcttggct
atctataccagattcacgaaattgggaacaccaaacaaagttgtctttgatgaagtgcat
tttggaaaatttgcatcttactatttagaaagaacgtatttttttgacttgcatccacca
ttcgctaaactcttgattgcatttgttggctggcttgtgggttacaatggtaaatttaaa
tttgacgctattggggattcatacattgaaaacaatgtgccatacattgcctaccggagc
cttctggctattcaaggaactgcgattatcccagttatgttcttgacgatgaagactttg
gggttcaatgtggcggcatgcttactctcgagcattatcgtttgttttgataacgcacaa
gttgcagacagtcgtttgattctcttggatgctacattgattttgagtgtcgcagctaca
atattttgctatagcaaattttcaatttacagaaaacaaccttttacccaaaaatggtgg
aaatggttaatatctactggtgtgtcactttcatgtgtcatttctacgaaatatgttggt
gtgttcacattcttcaccataggaattgcagttcttcacgagttgtggtttttgcttgat
tacaggaagggcttaacacttcaacagtttggtaagcatttttttgctagactatgggca
ttgatcattttgccatttaccatatatttattctggttctatttgcattttgccattttg
accaaatcaggacccggtgatgcatttatgtccgctgagttccaagagaccttgttagaa
tcacctttggcgcaacattctaaagacgttcaatattatgatgaaattacgatcaagcac
aaggataccggtgcatttttgcactcgcatttacacgattatcctttgcgttacgaagat
ggtagaatatcttccaacctgcagcaagtcacctgtgttattgaagatgatgccaaaaat
gacgaaaacaatgtttggcagattgttccagtgattgcagaagacgatggcaaaaagggt
aaatctgttttcactaacgatgtggttagattcaagcacaagggtacaggtggttttctt
ttaactcatgatgttgcttcgccattgaaagcaacaaatgaagagtttacagtcgtttac
aatgagactgcttccaacagatacaatgagacattgtttaggttgagattaaatgttcca
ggttccaatccaaagaaacaaaatcaaagaaaaaaggtatcaactatggcaacggaattg
agaatattgcatatggacacggttgtggctatgtggacccatgacgacgaactcttacca
gaatgggcatttcaacaacaagaggtaagtggtaacaaaaaaatccaggacaaagataat
atctggacattcgattcgatcaccaacttggcagaacacgattcaagaagcaagtatatt
cctaaaaagattaagaagataccatttttgaaaaaatggtgggaattgcaaggcttaatg
ttccaccacaacaaccagttgagttcgtcacacccatttgcatctcaacctgacgcatgg
ccacttgctttgagtggtgtttctttttataacaacaacgaggagaagaagcaaatcttt
ttccatggtaatgttattgggttctggcttgaagtgtgtttcttgtcagtctatgtcggt
atcctcttggcagatcaaatcactcttcgtcgtaattaccatttgttgaatgataaagca
agatcaagattgtacaacaccttgggattcttgtttataggatgggctgctcactattta
ccctttttcttgatgaatcgtcaaaagtttttacaccactatttaccagcacatctcatt
gctgcattgttcactggtggattggttgagtttatttgcacaaacaactccaacgatttt
aacagatccagtccacaatcgaagaaaatcaagatgaccgtgttagttagtttggcttcc
attggtataatttggttctttttttatttcagaccaattacttatggtgatgtttctttg
actcctgcagaagttcaaaagagacaatggttggacatcaaattgcattatgccaaatag

DBGET integrated database retrieval system