KEGG   Lodderomyces elongisporus: LELG_02216Help
Entry
LELG_02216        CDS       T01116                                 

Definition
histone deacetylase phd1
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
lel  Lodderomyces elongisporus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 440 aa AA seqDB search
MGSVTVPPTSVTDTFTVDKVTEENIPLYHPNKTSTLNVSYHYNPEVSRYHYGALHPMKPF
RLMLTDHLVISYKLYEKMDLYTPRKATKDELLQFHSEDYINFLQTITPEACKNLDELTLA
KFNIGDDCPIFDGMYDYLAIYAGASLDATRKLISGMSDIAINWSGGLHHAKKFEPSGFCY
VNDIVLSIINLLRVHPRVMYIDIDLHHGDGVQEAFYTTDRVMTVSFHKYNGEFFPGTGSV
DETGIGKGKNFAINVPLRDGIDDESYVRLFKLIMEPLITKFQPTCIVQQCGADSLGYDRL
GCFNLNIRAHGECVNFIKSFGIPMLVVGGGGYTPRNVSRLWCYETSVLNDVTLNHKIPNY
LPTYDWFGPDFSLHPQLEGRIDNKNSRKYLESVKQEIMEQIRYLNHAPSVQMYEIPPDIT
GLTEEEDEIIKELNEEANND
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtgttactgtgccaccaactagtgtgacagacactttcaccgtggataaagtc
accgaggaaaacattcctctttaccatccaaacaaaacatcaacgctcaatgtttcttac
cactacaacccagaagtaagccggtatcattatggggcactacatccaatgaaacctttt
agactcatgcttactgaccatttggtcatttcatacaaactatacgaaaagatggatttg
tacacacctcgaaaggccacaaaggatgaattacttcagttccactctgaggactacata
aattttttacaaacaatcactcccgaggcatgcaagaacctagatgaactgacattggcc
aaattcaacattggtgacgattgtcctattttcgacgggatgtacgattacctggctata
tatgctggtgcgtctttggatgccacaaggaaactcattagtggaatgtctgatattgcc
atcaactggtcaggaggactacatcatgccaaaaaatttgagcctagtgggttttgttat
gtcaatgatatagttttgagcattataaacttgctacgagtccatcccagagtcatgtat
atcgatattgatctccatcatggcgatggtgtacaagaagcattttacactacagatagg
gtaatgactgttagtttccacaagtacaatggagaattttttcctggtacgggatcggtc
gatgaaacggggatcggtaagggaaaaaactttgcaattaatgttccacttcgtgatggt
attgatgatgagagttatgtgcgattgtttaagctgataatggagccactcattactaaa
ttccagccaacgtgtattgtgcaacaatgtggtgccgattcgttggggtacgacagattg
ggctgtttcaatctaaacattagagcacacggggagtgcgtcaatttcatcaaaagtttt
ggaattccaatgcttgtggttggtggaggtgggtacacgccaaggaatgtgagccgacta
tggtgttatgagacgtctgtcttgaatgatgtcacattaaatcacaaaatacccaattac
ttgcccacttacgactggtttggaccagatttttcgcttcatccacagctcgagggaagg
atcgataataagaatagcaggaaatacctagaaagtgtaaagcaggaaattatggaacaa
ataagatacttgaatcacgcaccatctgtgcaaatgtatgagataccgcctgatatcacc
ggcttaacagaggaagaggacgagattattaaagagcttaacgaagaggcaaataatgat
tag

DBGET integrated database retrieval system