KEGG   Lodderomyces elongisporus: LELG_02216Help
Entry
LELG_02216        CDS       T01116                                 

Definition
(RefSeq) histone deacetylase phd1
  KO
K11483  histone deacetylase HOS2 [EC:3.5.1.98]
Organism
lel  Lodderomyces elongisporus
Brite
Enzymes [BR:lel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LELG_02216
Chromosome and associated proteins [BR:lel03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     LELG_02216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl Arm-DNA-bind_2
Motif
Other DBs
NCBI-GeneID: 5233701
NCBI-ProteinID: XP_001527387
UniProt: A5DXX9
AA seq 440 aa AA seqDB search
MGSVTVPPTSVTDTFTVDKVTEENIPLYHPNKTSTLNVSYHYNPEVSRYHYGALHPMKPF
RLMLTDHLVISYKLYEKMDLYTPRKATKDELLQFHSEDYINFLQTITPEACKNLDELTLA
KFNIGDDCPIFDGMYDYLAIYAGASLDATRKLISGMSDIAINWSGGLHHAKKFEPSGFCY
VNDIVLSIINLLRVHPRVMYIDIDLHHGDGVQEAFYTTDRVMTVSFHKYNGEFFPGTGSV
DETGIGKGKNFAINVPLRDGIDDESYVRLFKLIMEPLITKFQPTCIVQQCGADSLGYDRL
GCFNLNIRAHGECVNFIKSFGIPMLVVGGGGYTPRNVSRLWCYETSVLNDVTLNHKIPNY
LPTYDWFGPDFSLHPQLEGRIDNKNSRKYLESVKQEIMEQIRYLNHAPSVQMYEIPPDIT
GLTEEEDEIIKELNEEANND
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtgttactgtgccaccaactagtgtgacagacactttcaccgtggataaagtc
accgaggaaaacattcctctttaccatccaaacaaaacatcaacgctcaatgtttcttac
cactacaacccagaagtaagccggtatcattatggggcactacatccaatgaaacctttt
agactcatgcttactgaccatttggtcatttcatacaaactatacgaaaagatggatttg
tacacacctcgaaaggccacaaaggatgaattacttcagttccactctgaggactacata
aattttttacaaacaatcactcccgaggcatgcaagaacctagatgaactgacattggcc
aaattcaacattggtgacgattgtcctattttcgacgggatgtacgattacctggctata
tatgctggtgcgtctttggatgccacaaggaaactcattagtggaatgtctgatattgcc
atcaactggtcaggaggactacatcatgccaaaaaatttgagcctagtgggttttgttat
gtcaatgatatagttttgagcattataaacttgctacgagtccatcccagagtcatgtat
atcgatattgatctccatcatggcgatggtgtacaagaagcattttacactacagatagg
gtaatgactgttagtttccacaagtacaatggagaattttttcctggtacgggatcggtc
gatgaaacggggatcggtaagggaaaaaactttgcaattaatgttccacttcgtgatggt
attgatgatgagagttatgtgcgattgtttaagctgataatggagccactcattactaaa
ttccagccaacgtgtattgtgcaacaatgtggtgccgattcgttggggtacgacagattg
ggctgtttcaatctaaacattagagcacacggggagtgcgtcaatttcatcaaaagtttt
ggaattccaatgcttgtggttggtggaggtgggtacacgccaaggaatgtgagccgacta
tggtgttatgagacgtctgtcttgaatgatgtcacattaaatcacaaaatacccaattac
ttgcccacttacgactggtttggaccagatttttcgcttcatccacagctcgagggaagg
atcgataataagaatagcaggaaatacctagaaagtgtaaagcaggaaattatggaacaa
ataagatacttgaatcacgcaccatctgtgcaaatgtatgagataccgcctgatatcacc
ggcttaacagaggaagaggacgagattattaaagagcttaacgaagaggcaaataatgat
tag

DBGET integrated database retrieval system