KEGG   Lodderomyces elongisporus: LELG_02337Help
Entry
LELG_02337        CDS       T01116                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
lel  Lodderomyces elongisporus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lel03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1139 aa AA seqDB search
MYSRPSAAFKPPRPQSRSDVDATATATTSSTTTASLSNESRVGSKNAAAIASVPLKARPN
LKRVYADDASGYSTTTNITADTNTTHINSTKRPNTHTLLLSDSVSLLNGSSSPLKKVSNT
KYIVLWRRKTNKKNKSWDGDGQATIKYTPGNDACDIVLKGSDGGIMSRKTFKPPPNLTEI
IPIGGFEISLDEEIGLGSIIPREVITSTNNNGNNDQVRLKPISLVASTSELKRAPTGLSK
RATSAVGVAGGVAAAAVGAAGVAAAGAASSGTPSSGTIAPVLRRASSLPKHAENKSADQM
TKDTPSNNGEVKKELLDAKYLIQWRKKTTKKNKSWDGDGSALIKFSGLGCEIVVKNSDGK
VMSKKKFDKLPDLSEVIPIGVFEIFLDEKIAELENNIAETSEVQAIDAPSELSTHEQNPI
LSTLPGAPPPPPPPPTSTRASASASSTVLHKSFKKVIPKDHEQVQEKRNALYEEKADEVQ
MTPPPEEPDPVKVSIDPHLASKLRPHQIEGVTFMYECVMGFRDFVGNGCLLADEMGLGKT
LMTITTIWTLLKQNPFPDQKKPIVNKVLIVCPVTLINNWKAEFKKWLGTNKLNVLTLNNP
MSDDKRDIVNFGRLNVYQVLIINYEKVLAHLEELQTVNFDLLVCDEGHRLKNSSNKVLIN
LHKLLIPKRIVLTGTPIQNYLVEFHTLISFINPAVLPDMKTFQRKFINPITQARDVNCFN
PEVKRKGEELSKELIRLTHKFILRRTQDLLEGYLTPKTDILLFVPPTQLQIDIFQLIRSS
EKFKYLEPGLTSLALINVFRKICNSPSLLATDEFYQKIATNTFKLSTSSGKIHVLIPLLL
EITECKERTVLISNYTKTLDLLEHVLRKLNLRYTRLDGSTPNNMRNKLVNEFNRNEEIHV
FLLSSKSGGMGINLVGASRLILFDNDWNPSTDLQSLSRIHRDGQTKPCFIYRLFTAGCID
EKIFQRQLMKSKLSSKFLDNDNASKTDVFEQEDLKNLFEVNVGSKSNTHELLGCSCAGDG
SLLTQEIFTDDEIDADDDAKIEDEDYSDNDVSEVQVQASQRWMSAAELQKNMDRNGADVM
EKRAVKDALNDYHHYDPEISHDLAFDPVLLQIAKNSVTQGRLPFSFIMMKQSAGRDDKK
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgtattcccggccaagtgctgcctttaaaccaccaagaccacaatcaagatcagatgtg
gatgcaactgcaactgcaactacaagttcaactacaacagcatcactgagtaatgagagt
agggttggaagcaaaaatgctgctgccatcgcgagcgtaccgttgaaggcgcgtcctaac
ctcaaaagagtgtacgctgatgacgcgtcaggttactcaaccaccaccaacatcactgct
gatactaatacaactcatataaatagtactaaaaggccaaatacccataccttactactg
agtgattccgtttcactgttgaatggttcctcttccccactgaaaaaagtctccaacaca
aagtacatagtcttatggaggagaaagacaaataagaaaaacaagagctgggatggcgac
ggccaagcaacgatcaaatataccccgggtaatgatgcatgtgatattgtacttaaaggc
agtgacggaggtattatgagtagaaagacattcaaaccgccaccaaacttgacagaaatt
atccctattggtggatttgaaatttcacttgatgaagagataggattgggatctatcata
ccaagagaggttatcacttccactaacaacaatggtaacaatgatcaagtacgtttaaaa
cccatatcgctggttgcatctacttctgagcttaaacgagctccaactggtcttagcaag
cgagctacatctgctgttggtgttgctggtggtgtcgctgctgctgctgttggtgctgct
ggtgttgctgctgctggtgctgctagctctggtactcctagctctggtactattgctcca
gtactgcggcgagcttcttctttaccgaaacatgcagaaaataaaagtgcagaccaaatg
acaaaagacacgccaagcaataatggcgaagtaaaaaaagagttactagatgcaaagtac
ttgatccagtggagaaagaaaacaacgaaaaagaacaaaagctgggatggcgatggcagt
gccttgatcaagttttctgggttgggttgcgaaatagtagtcaaaaactctgatggtaag
gtcatgagtaaaaaaaaatttgataaactgccagatttgagtgaggtgattccaattgga
gtttttgaaatctttttagatgaaaagattgcagaactggagaataacatcgcggagaca
agtgaggtgcaagcaattgatgccccatcagaattatctactcatgaacaaaaccctatt
ctttccactcttccaggtgcacctccacctcctccacctcctcctacatctacgcgtgct
tctgcatctgcttcatcaacggtgttgcacaagagttttaaaaaagtaattccaaaggac
cacgagcaagtacaagaaaagaggaatgcgctttatgaagaaaaggctgatgaagtacaa
atgacaccaccgccagaggaaccagatcctgttaaagtgagtatagacccgcatttagcc
tccaaattgagaccgcatcaaatcgaaggtgtcacattcatgtatgaatgtgttatgggg
tttagagattttgttgggaatggatgcttgttggctgatgaaatggggcttggcaaaaca
ctcatgaccatcaccactatatggactttgctcaaacaaaatccatttcctgatcaaaaa
aagccaatcgtcaataaggtattgattgtttgtcctgtgacattgatcaataactggaag
gcagagttcaagaaatggcttggtacgaacaaactaaacgtgttgacgctaaacaatcca
atgtctgatgacaaaagagacattgtcaactttggaaggttaaatgtctaccaagtatta
ataatcaactatgagaaagttcttgctcatttggaggaattgcaaactgttaattttgat
cttttggtatgcgatgaaggccatagactcaagaacagctccaataaggtgctcatcaat
ttgcacaaactactgataccaaagagaattgttttaaccggtacaccgattcaaaactat
ttggttgagtttcataccttaatatccttcataaatccagctgttttgccggacatgaaa
accttccaacgaaaatttatcaaccccataacgcaagctagagatgtcaattgctttaac
ccagaagtaaaaagaaaaggtgaagaattatccaaagagttgattagattaactcacaag
ttcatattacgaagaacacaggacttgctcgaagggtacttgacaccaaaaacagatatt
cttcttttcgtacctcctactcagcttcaaattgatattttccaactgattagaagttcc
gagaaattcaagtatctcgaaccgggactgacctcgctagcattgattaatgtgtttcgt
aaaatatgcaactcgccatcattattagcaacagatgaattttaccaaaaaattgcaaca
aatactttcaagctatctacaagctccggcaaaatacacgtacttataccattgttattg
gagattacagaatgcaaagagagaacggttctcatttcaaactacaccaaaacactcgat
ttgttggaacatgtgttgaggaagcttaatctccgctacacgcgcctagacgggtcaacg
ccaaacaatatgcggaacaagctagtaaatgagtttaacagaaatgaagaaattcatgtt
ttcctcctctcttccaagtctggtggtatgggtataaatttagtcggtgcatcgcgactc
attcttttcgacaacgattggaatccatctactgatcttcagtcgttatcgcgaattcat
agggatggacaaaccaaaccatgtttcatttacaggttgttcactgcagggtgtatagat
gaaaagatttttcagcgtcaattgatgaagagcaaactttcatccaagtttctagataat
gataatgcgtcgaaaacagatgtatttgaacaagaggatttaaaaaatttgtttgaagtg
aatgtggggtctaaatcaaatacacatgagctactaggctgttcgtgcgctggtgacgga
tcgcttttgacgcaagaaatttttacagatgacgaaattgatgcagatgatgatgctaaa
attgaagatgaggactacagtgataacgacgtgtctgaagttcaagtacaggcttctcaa
aggtggatgtctgcggcagaattgcaaaaaaatatggaccgaaatggcgccgatgtgatg
gagaaaagagctgttaaggatgcccttaatgactatcatcattatgatcccgagatatct
cacgatcttgcatttgacccagtgttgttgcagattgcaaagaatagcgtgacacaaggt
agattgccattttcatttatcatgatgaagcaatcagcaggtagagacgataaaaagtag

DBGET integrated database retrieval system